KEGG   Mus musculus (mouse): 399568Help
Entry
399568            CDS       T01002                                 

Definition
(RefSeq) cDNA sequence BC052040
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TPD
Motif
Other DBs
NCBI-GeneID: 399568
NCBI-ProteinID: NP_997147
MGI: 3026886
Ensembl: ENSMUSG00000040282
Vega: OTTMUSG00000015218
UniProt: Q3U4G0
Position
2; 2 E4
AA seq 281 aa AA seqDB search
MILTKAQYEEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHH
TPEAIESYYQRYLNGVGKNGAAPVLLELANEVDYAPSLMARIILERFLQGHEQTPPSKSV
INSMLRDPSQIPDGVLANQVYQCIVNDCCYGPLVDCIKHAIGYEHEVLLRDLLLKKNLSF
LDEDQLRAKGYDKTPDFILQVPVAVEGHIIHWIESKASFGDECSHHAYLHGQFWSYWNRF
GPGLVIYWYGFIQELDCNRERGILLKASFPTDIVTLCHSTA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatactaaccaaagcccagtacgaggagatagcccagtgcctagtgtctgtaccgccc
actaggcagagcctgaggaagctgaagcagaggttccccagtcaatcgcaggccactctg
ctgagcatcttctcccaggagtaccagaaacatattaaaagaacacatgccaaacatcac
actccagaagcgattgaaagttactaccagaggtacctgaatggcgtggggaaaaacgga
gcagcccccgtgctcttggagctggccaatgaggtggactatgcaccctcattaatggct
cggattatcctggagagatttctacaggggcatgaacagactccaccctccaagtctgtt
ataaacagtatgctgcgggacccttctcagattccagatggagttctagcaaaccaggtc
tatcagtgcatcgtgaatgactgttgctatggaccgctggtggactgcatcaagcacgct
attggctatgagcatgaagtcctgctgagagacttgcttctgaagaaaaacctgtcgttc
ctagatgaggatcagctccgtgcaaagggctatgacaaaaccccagacttcattttacag
gtgccagttgctgtggaagggcacataattcactggattgaaagcaaagcctcatttggt
gatgaatgtagccaccacgcctacctgcatggccaattctggagctactggaataggttt
ggaccaggcctggtcatctattggtatggatttatccaggaactggactgcaaccgggaa
agaggcatcctgctcaaagcctcgttccccacagacatcgtcaccttatgccatagcaca
gcttga

DBGET integrated database retrieval system