KEGG   Mus musculus (mouse): 399603Help
Entry
399603            CDS       T01002                                 

Gene name
Fam84b, BF642811, D330050I23Rik
Definition
(RefSeq) family with sequence similarity 84, member B
  KO
K22810  protein FAM84B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    399603 (Fam84b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     399603 (Fam84b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT NLPC_P60
Motif
Other DBs
NCBI-GeneID: 399603
NCBI-ProteinID: NP_001156398
MGI: 3026924
Ensembl: ENSMUSG00000072568
Vega: OTTMUSG00000047161
UniProt: D3YXJ5
Position
15; 15 D1
AA seq 310 aa AA seqDB search
MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGLDGGALS
DSGDRPPLPPPQPYDPRQHEVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCSPGD
LVEFVSQAQYPHWAVYVGNFQVVHLHRLEVSNSFLTDASQGRRGRVVNDLYRYKPLSPSA
VVRNALAHVGAKERELSWRNSESFAAWCRYGKREFKIGGELRIGKQPYRLQIQLSAQRSH
TLEFQSLEDLIMEKRRNDQIGRAAVLQELATHLHPAEPDEGDSDATRTTPSPLRPPASGS
EEENGDSVVH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccaggtggaaaaactgacccacctaagttataaggaagttcccacggccgac
ccgaccggcgtggatcgagacgatgggccccgcatcggagtctcttatattttctccaat
gacgacgaggatgtggaacctcagccaccgccccaggggcttgatggcggagctttgtcc
gactccggggatcggcctcccctgcccccgccgcagccctacgacccgcggcagcacgag
gtggaatgctcggtgttttatcgtgatgagtgcatctatcagaaaagcttcgcgccagga
tcggcggctctgagcacctacacaccggagaacttgctcaacaagtgcagtccgggtgac
ctggtggagtttgtatcgcaggctcaatacccgcactgggctgtctacgtgggcaatttc
caggtggtgcatttgcaccggctggaggtgagcaacagcttcctgaccgatgcgagccag
ggccggcgcggccgcgtggtcaacgatctgtatcgctacaagccactgagccctagcgct
gtagtgcgcaacgcgctggcccacgtgggcgccaaggagcgcgagctcagctggcgcaac
tccgagagctttgcggcctggtgccgctatggcaaacgcgagttcaagatcggtggcgag
ctgcgcatcggcaagcagccctaccgtttgcagattcagctctcggctcagcgcagccac
actctcgagttccagagcctggaggacttgatcatggagaagcggcgcaacgaccagatc
ggacgcgcggcggtgctacaggagctcgccacgcacctgcacccggctgagccggatgag
ggcgacagcgacgcgactcggactacaccgtcccccctgcgtcccccagcatcgggctcc
gaggaggagaacggagactcggtcgtgcactga

DBGET integrated database retrieval system