KEGG   Mus musculus (mouse): 403174Help
Entry
403174            CDS       T01002                                 

Gene name
Msantd1, A930005I04Rik, Gm144
Definition
(RefSeq) Myb/SANT-like DNA-binding domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-bind_4 MADF_DNA_bdg
Motif
Other DBs
NCBI-GeneID: 403174
NCBI-ProteinID: NP_997160
MGI: 2684990
Ensembl: ENSMUSG00000051246
Vega: OTTMUSG00000055723
UniProt: Q8BIL2
Position
5; 5 B2
AA seq 278 aa AA seqDB search
MVRWPGLRPCLSAILNPAGASNMAAAEVPGYLVSPQTEKHRRARNWTDAEMRGLMLVWEE
FFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESIPP
DWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEASLSPSAKSTPLYLPYTQCSYEG
HFEDDRSDSSSSLLSLKFRSEERPVKKRKMRSCHLQKKKLRLLEAMLEEQRRLSRAMEET
CREVRRVLDQQNILQVQSLQLQERMMSLLEKIIAKSNV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgctggccaggcctgaggccctgcctgagtgccatccttaaccctgcaggtgcc
tccaacatggcagcagccgaagtgcctggctaccttgtgtctcctcagacggagaagcat
cggagggcccgcaactggacagatgcagagatgcgcggcctcatgctggtctgggaggag
ttctttgatgagctcaagcagaccaagcgcaatgccaaggtgtacgagaagatggccagc
aagctctttgagatgactggggagcgacggctaggcgaggagatcaagatcaaaatcacc
aacatgaccttccagtacaggaaattaaaatgcatgacagatagcgagtccatcccgccg
gactggccctattacctagccattgataggattctggccaaggtccctgagtcctgtgag
ggcaaactgccggatggccagcagccggggccctctacgtcccagaccgaggcgtccctg
tcgccgtctgctaagtccacccctctgtacttaccgtatacccagtgctcctatgaaggc
cacttcgaggacgatcgctccgacagctcctccagcttactgtcccttaagttcaggtca
gaggaacgccccgtgaagaaacgcaagatgcggagctgtcacctacagaaaaagaagctg
cgactgctggaggccatgctggaggaacagcgccggctgagccgtgccatggaggagaca
tgccgagaggtgcgccgtgtgctggaccagcagaacatcctgcaggtccagagcctgcag
cttcaggagcgaatgatgagcctactggagaagatcattgccaagtccaacgtctag

DBGET integrated database retrieval system