KEGG   Mus musculus (house mouse): 403175
Entry
403175            CDS       T01002                                 
Symbol
Tigd4, C130063O11Rik, Gm418
Name
(RefSeq) tigger transposable element derived 4
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DDE_1 HTH_Tnp_Tc5 CENP-B_N CENP-B_dimeris HTH_23 UPF0122 HTH_Tnp_1 HTH_28 DDE_3
Other DBs
NCBI-GeneID: 403175
NCBI-ProteinID: NP_997161
MGI: 2685264
Ensembl: ENSMUSG00000047819
UniProt: Q8BUZ3
Position
3:84500881..84504339
AA seq 513 aa
MAEASVDIGTQPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNK
DKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK
LGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPSTVWYQNVLPYYLNDYHPKNVF
NVKETGLLYRMLPTNTFAFKGETCSVGKLCKDRITLALGTNMDGSEKLPLLIIGKNRAPR
CFKGIKSLPVYYEANRTAWMTAAIFEQWMQKLDEKFQAQKRRVVIFVDSCPAHPEVKNLK
SIELAFFPSCLSSGFAAMNQGVIKSLKIKYRHCLIKKFLSSVESSKEFTFSLLDAVDTLH
LCWRAVTPETIVKSYEEAGFRSPKGENDTANADAAVALDLTAHAVGAGVEFLEGLSIEEY
AALDEDLETCEATQKDDAEWAGESKQDETGLYTSDEEEEDSGALEVDLPSPSKKDALSAV
GTLKRFLRSHDLNDELHGSLADLENFINALSPK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcagaagcctctgtggatatcgggactcagcccgtaaccgtgaagaaaaagaagagc
ctgtccatcgaggagaagattgacatcataaatgcagtggaaagtggcaagaaaaaggca
gagattgcagctgaatatggcataaagaaaaattcattgtcttccattatgaaaaacaaa
gacaaagttctagaagcctttgagtctttgagatttgatccgaagagaaaaagactgaga
acagcgttttatacggatctagaagaagcattgatgaggtggtatcggattgctcagtgt
ctaaacgttccagttaatggcccgatgttgcgtctaaaagctaatgattttgcccagaag
ctgggacacaatgattttaagtgcagcaatggttggctggatcgttttaagtccaggtat
ggcttagtattcagagcacaacccgtagaagccacgggtatatctatagacccttccact
gtgtggtaccaaaatgtgctaccttattacttaaatgattatcatcctaaaaatgttttc
aatgtaaaagagactgggttgctttatcgaatgttacctacaaatacttttgcattcaaa
ggggaaacatgctcagttggaaagttgtgcaaagacaggataacgctggcactcggaaca
aatatggatggctctgagaagctccctttgctgatcatcgggaaaaaccgagccccgcgt
tgtttcaagggcataaaatcattgcctgtgtactatgaagctaacagaacggcgtggatg
accgcagccatattcgagcagtggatgcagaagctggatgagaaattccaagcccagaaa
cgaagagtggtgatttttgttgactcttgccccgcacatccggaagtgaaaaacctaaag
tccattgagttggcattcttcccgtcatgcttgtcttccgggtttgcagctatgaatcaa
ggtgttattaaaagccttaaaatcaaatatcggcattgtcttatcaagaaatttttaagt
tcagtcgaaagtagcaaagagtttacattttctcttctagatgcagttgatacattgcat
ctctgctggagagctgtaactccagagactattgttaaaagctatgaagaagcaggattc
aggtctccaaagggagaaaatgacacagccaatgcagatgctgctgttgctcttgacctg
actgcccatgcagtgggggcaggagtggagtttcttgaaggcttgtccatagaggaatac
gctgccctggatgaggacctggagacttgtgaagccacccagaaagatgatgccgagtgg
gccggagaaagtaagcaagacgaaactggtctttatacttccgatgaagaggaggaggac
agcggggcgctagaagtggatctgccgtcaccatccaagaaggacgcgctctcagctgta
ggcactctgaaaaggtttcttagaagtcacgacctgaatgatgaacttcacggttcttta
gcagaccttgaaaactttattaacgctttgtcacctaagtag

DBGET integrated database retrieval system