KEGG   Mus musculus (house mouse): 403187
Entry
403187            CDS       T01002                                 
Symbol
Opa3, D630048P19Rik, Gm1425, Gm472
Name
(RefSeq) optic atrophy 3
  KO
K23166  optic atrophy 3 protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    403187 (Opa3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    403187 (Opa3)
SSDB
Motif
Pfam: OPA3 DUF2730 Cep57_MT_bd
Other DBs
NCBI-GeneID: 403187
NCBI-ProteinID: NP_997408
MGI: 2686271
Ensembl: ENSMUSG00000052214
UniProt: Q505D7
Position
7:18962314..18980742
AA seq 179 aa
MVVGAFPMAKLFYLGIRQVSKPLANRIKDAARRSEFFKTYICLPPAQLYHWVEMRTKMRI
MGFRGTTIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQTQQRNKEEEQRAAWN
ALQDEVGRLALALEALQAQAQAMPSLSALEELREELQEVRGQVCNAHCTSKCQAASSKK
NT seq 540 nt   +upstreamnt  +downstreamnt
atggtggtgggcgcgttccccatggcgaagctgttctacttgggcatccggcaggttagc
aagccgctggccaaccgtatcaaggatgctgcccgccgcagcgagttcttcaagacctac
atctgcctaccgccagcccagctgtaccactgggtggagatgcggacgaagatgcgcata
atgggtttccggggcactaccatcaagccactgaatgaggaggcagcagcagagctgggt
gctgagctgctgggcgaggccaccatcttcattgtgggcggaggctgcctggtcctggag
tactggcgccaccagactcagcagcgcaataaggaggaggaacagcgggcagcctggaac
gctctgcaggatgaggtgggccgcctggcactggccttagaggcgctgcaggctcaggca
caagcgatgccctccttgagtgccctggaggagctgcgggaggagctgcaggaggtgcgt
ggtcaggtctgcaatgctcactgtacttccaagtgccaggcagcatcttccaagaaatag

DBGET integrated database retrieval system