KEGG   Mus musculus (mouse): 404194
Entry
404194            CDS       T01002                                 

Symbol
Gfral, AY457637, Gral
Name
(RefSeq) GDNF family receptor alpha like
  KO
K24156  GDNF family receptor alpha-like
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    404194 (Gfral)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    404194 (Gfral)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 404194
NCBI-ProteinID: NP_995316
MGI: 3607786
Ensembl: ENSMUSG00000059383
Vega: OTTMUSG00000044824
UniProt: Q6SJE0
Position
9:complement(76071384..76120939)
AA seq 393 aa
MLVFIFLAVTLSSENESSSQTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINN
SLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTP
FYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPF
NTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTF
QTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAE
EHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNGELLYVVVCMAV
TCGILFLVMLKLRIQSEKRDPSSIEIAGGVIIQ
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctagtgttcattttcctggctgttacgttaagctcagaaaatgaatcctcttcccaa
acaaatgattgtgcacatttaatacagaaatgcttgattgatgcaaatggctgtgagcag
tcatggagatcaatggaagacacctgccttactccaggtgactcctgcaagataaataat
tcactacattgtaacctgagtatccaggctttggtggaaaaaaatttccaatttaaagag
tgtctttgtatggatgacctccactgtacagtaaacaaactttttggaaaaaagtgcacc
aataagacagataacatggaaaaggacaataaagataaatggaatctaactactactcct
ttctatcatggattcaaacagatgcagtcttgtttggaggtgacagaggcgtgtgtaggg
gatgtggtttgtaatgcacagttggccctttaccttaaagcatgctcagcaaatggaaat
ctgtgtgatgtgaaacactgccaagcagccatacggttcttctatcaaaatatgcctttt
aacactgcccagatgttggctttttgtgactgtgctcaatctgatataccctgtcagcaa
tccaaagaaactcttcacagcaagccatgtgcactgaatatagttccaccccccacttgc
ctcagtgtaattcacacttgccgaaatgatgaattatgcaggacacactaccgaacattc
cagacagaatgctggccccacataactgggaagtgccatgaagatgagacctgcattagc
atgttaggcaagcaagaccttacttgttctgggagtgagagctgcagggctgccttccta
ggaacctttgggacagtcctgcaagtaccctgtgcttgcaggggcgttacacaggctgaa
gaacacgtgtgcatgattttccagcacatgcttcatagcaaatcgtgtttcaattaccca
actcctaatgtcaaagacatttcctcatatgaaaaaaagaattcaaaagaaattactctg
actggattcaattctttcttcaatggagaactactctatgttgttgtgtgcatggcagtt
acctgtggaattcttttcttggtgatgctcaagttaaggatacaaagtgaaaaaagagat
ccctcatccatcgaaatagctggaggtgtcatcattcagtga

DBGET integrated database retrieval system