KEGG   Mus musculus (mouse): 404195Help
Entry
404195            CDS       T01002                                 

Gene name
Cyp2c54, EG404195
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 54
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu04726  Serotonergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    404195 (Cyp2c54)
   00590 Arachidonic acid metabolism
    404195 (Cyp2c54)
   00591 Linoleic acid metabolism
    404195 (Cyp2c54)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    404195 (Cyp2c54)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    404195 (Cyp2c54)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    404195 (Cyp2c54)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    404195 (Cyp2c54)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    404195 (Cyp2c54)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     404195 (Cyp2c54)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   404195 (Cyp2c54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 404195
NCBI-ProteinID: NP_996260
MGI: 3642960
Ensembl: ENSMUSG00000067225
UniProt: Q6XVG2
Position
19; 19 C3
AA seq 490 aa AA seqDB search
MDPILVLVLTLSCLFLLSLWRQSYERGKLPPGPTPLPIIGNILQIDVKDICQSFTNLSRV
YGPVYTLYLGRKPTVVLHGYEAVKEALVDHGDVFAGRGRLPVFDKATNGMGIGFSNGSVW
KNTRHFSLMTLRNLGMGKRSIEDRVQEEARCLVEELRKTNGSPCDPTFILGCAPCNVICS
IIFQDRFDYKDRDFLNLLEKLDEISKILSTPWLQVCNTFPALLDYCPGSHNQFFKNYAYI
KNFLLEKIREHKESLDVTIPRDFIDYFLIKGAQEDDNHPLKNNFEHLAITVTDLFIGGTE
SMSTTLRYALLLLLKYPHVTAKVQEEIEHVIGKHRRPCMQDRSHMPYTNAMIHEVQRFID
LVPNNLPHEVTCDIKFRNYFIPKGTTVITSLSSVLRDSKEFPNPEKFDPGHFLDENGKFK
KSDYFMPFSTGKRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDITPMLIGLGSVP
PAFQLCFIPS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccaatcctggtcctggtgctcactctctcctgtctgtttctcctctcactctgg
agacagagctatgaaagagggaagcttccccctggccccactcctcttccaattattgga
aacatccttcagatagatgtgaaggacatctgccaatccttcaccaatttatcaagagtt
tatggtcctgtgtatactctatatttgggcaggaagcccactgtggtgttgcatggatat
gaggcagtgaaggaagctctggttgaccatggggatgtctttgctggaaggggaaggctc
ccagtttttgataaagctactaatggaatgggcattggatttagtaatggaagtgtatgg
aaaaacacgaggcacttctcactcatgactctgcggaatttaggcatgggaaaaaggagc
attgaggaccgtgttcaagaggaagcacgttgccttgtggaggaacttaggaaaaccaat
ggctcaccctgtgatcccaccttcatcctgggctgtgctccctgcaatgtcatctgctca
attattttccaggatcgttttgattataaagatcgggattttctaaacttgttggaaaaa
ctggatgaaatatccaagattctgagcaccccctggttgcaggtttgcaatacatttcct
gctctgcttgattattgtccaggaagtcataaccaattttttaaaaattatgcttatatt
aaaaatttccttttggagaaaataagggaacataaagaatcattggatgttacaattcct
cgggactttattgattatttcctaattaaaggagcccaggaagatgacaatcatcctttg
aaaaataattttgaacacctggcaataacagtgactgatctttttattggtgggacagag
tcaatgagcacaacactgagatatgctctcctactcctattgaagtacccacatgtcaca
gctaaagtccaggaagaaattgagcatgtgatcggcaagcaccgaagaccatgcatgcag
gacaggagccacatgccctatacaaatgccatgattcatgaggtccagagattcattgac
cttgtccccaacaacctgccccatgaagtgacctgtgacattaaattcaggaactacttc
attcccaagggaacaactgtaataacatcactgtcatcagtgctgcgtgatagcaaggag
ttccccaacccagagaagtttgaccctgggcactttctagatgagaatggaaagtttaaa
aaaagtgactacttcatgccattctcaacagggaaacggatatgtgcaggagagggcctg
gcacgcatggagctgttcctgttcctaaccagcattttacagaacttcaacctgaaacct
ctggttcacccaaaggacatagatataaccccaatgctcattggattgggctcagtgcct
cctgctttccagctctgcttcattccttcctga

DBGET integrated database retrieval system