KEGG   Mus musculus (mouse): 404322
Entry
404322            CDS       T01002                                 

Gene name
Olfr924, MOR171-27P, MOR171-47, Olfr1520-ps1
Definition
(RefSeq) olfactory receptor 924
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    404322 (Olfr924)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    404322 (Olfr924)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    404322 (Olfr924)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 404322
NCBI-ProteinID: NP_997443
MGI: 3030758
Ensembl: ENSMUSG00000062103
Vega: OTTMUSG00000062205
UniProt: Q7TRB8
Position
9; 9 A5.1
AA seq 308 aa
MNHSSVIDFILEGLTKRPELQLPLFLLFLAIYVITVVGNLGMILLITISSQLHSPMYYFL
SHLSFIDLCYSSVITPKMLVNFVCEKNTISFLECMTQLYFFLIFVIAEGYLLTAMAYDRY
VAICSPLLYNIVMSHKVCSIMMAVVYSLGFFGATVHTTRMTMLSFCGSHIVSHYFCDILP
LLTLSCSSTHINEVLLFIIGGVNTLAPTLAVIISYAFILTSILRIRSNEGRSKAFGTCSS
HIMAVGIFFGSITFMYFKPPSSNNMEQEKVSSVFYTTVIPMLNPLIYSLRNKDVKNALKK
MVGGRQLS
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaatcattcttcagtgattgattttatcctcgaaggattaacaaaacgcccagagctt
cagctcccactgttcctcttgtttctggcaatatatgtgatcacagtagtgggaaacttg
ggcatgatcctcttaatcaccattagttctcaacttcactctccaatgtattattttctc
agtcacttatccttcattgacctctgctattcctctgtcattacaccaaagatgttggtg
aactttgtatgtgagaagaacacaatctcctttttggagtgcatgactcagctttacttc
ttcctcatttttgttattgcagaaggctacctgctgacagccatggcctatgaccgctat
gttgccatctgtagcccactgctttataacattgtcatgtcccacaaggtctgttccata
atgatggctgtggtatactcactgggcttctttggggctactgtccatacaacccgtatg
acaatgttgtccttctgtgggtctcatattgtcagccactatttttgtgatatcctacct
ttgttgactctgtcttgctcaagcacccatatcaacgaggtactgctgtttattattggt
ggagttaatacccttgcacctacactggctgtcatcatctcttatgctttcattctgaca
agtattcttcgcatccgctccaatgaaggacgttccaaagcatttggcacctgtagctcc
cacattatggctgtgggaatcttctttgggtcaattactttcatgtatttcaagccacct
tccagtaataatatggaacaggagaaagtgtcctctgtgttctacaccacagtgatccct
atgctaaatccccttatatacagtctgaggaacaaggatgtaaagaatgcactgaaaaag
atggttggtggaaggcagctatcctga

DBGET integrated database retrieval system