KEGG   Mus musculus (mouse): 404545Help
Entry
404545            CDS       T01002                                 

Gene name
Ano7, Ngep, Ngep-L, Pcanap5, Tmem16g
Definition
(RefSeq) anoctamin 7
  KO
K19501  anoctamin-7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    404545 (Ano7)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   404545 (Ano7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anoctamin Anoct_dimer
Motif
Other DBs
NCBI-GeneID: 404545
NCBI-ProteinID: NP_996914
MGI: 3052714
Ensembl: ENSMUSG00000034107
Vega: OTTMUSG00000048653
UniProt: Q14AT5
Position
1; 1 D
AA seq 859 aa AA seqDB search
MLRGQAREEDSVVLIDMASPEAGNGCSYGSTAQASEAGKQQVAPSRVGSSAKPPIDFVLV
WEEDLRNQENPTKDKTDTHEVWRETFLENLCLAGLKIDQHDVQDEAAAVHYILLRAPWAV
LCYYAEDLRLKLPLQELPNQASNWSATLLEWLGIPNILLEHVPDTPPEYYSCQFKASKLQ
WFLGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKGLFGIDQLLAEGVFSAAFPLHDGPF
SAVPESSQVLGLIQRQVLFQHWARWGKWNKYQPLDHVRRYFGEKVALYFAWLGFYTGWLL
PAAVVGTVVFLVGCFLVFSDIPTQELCHSSDSFDMCPLCSDCSFWLLSSACTLAQAGRLF
DHGGTVFFSLFMALWAVLLLEYWKRKNATLAYRWDCSDYEDIEERPRPQFAATAPMTALN
PITGEDEPYFPEKNRVRRMLAGSVVLLMMVAVVIMCLVSVILYRAVMAIIVSRSDNAFLS
AWASRIASLTGSVVNLVFILILSKVYVLLAQVLTRWEMHRTQTEFEDAFTLKVFIFQFVN
FYASPVYIAFFKGRFVGYPGNYHTLFGIRNEECPAGGCLSELAQELLVIMVGKQIINNVQ
EVLVPKLKGCWQKFSRGKKAGTGTHPAPWEADYELLPCEGLFHEYLEMVLQFGFVTIFVA
ACPLAPLFALLNNWVEIRLDARKFVCEYRRPVAERAQDIGIWFHILTGLTHLAVISNAFL
LAFSSDFLPRVYYSWTHAPDLHGFLNFTLARAPPTFTSAHNRTCRYRAFRDDDGHYSPTY
WTLLAIRLAFVIVFEHVVFSIGRVLDLLVPDIPESVEIKVKREYYLAKQALAENEALLGA
TGVKDDQPPSSEPSLGLPA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggggcaagcgcgagaagaagacagcgtggtgctgatcgacatggcctcccct
gaagcagggaatggatgctcctatgggagcacagcccaagcctcagaggcaggtaaacag
caggtggcccccagcagagttgggagctctgccaaacccccaattgattttgttcttgtt
tgggaagaagacctgaggaaccaagagaaccccacgaaggacaagacagacacacacgag
gtctggcgggagacttttctggagaatctttgcttggctggcctgaaaatagatcagcat
gatgtccaggatgaggccgctgcagttcattacatcctcctccgcgcaccctgggctgtg
ctttgctactatgcagaagacctgcgcctgaagctgcctctacaggagttacccaaccag
gcctccaactggtcagccacccttctggagtggctgggcatccccaatatcctgctggag
cacgtgcctgacacgccccccgagtattactcctgccagttcaaagcaagcaagctgcaa
tggtttcttgggagtgacaaccaagacaccttcttcaccagcaccaagaggcatcagatt
ctatttgagatcctggccaagactccatatgggcacgagaagaaaggcctgtttgggatt
gaccagctgctggcagaaggtgtattcagtgcagccttccctctgcatgacggcccattc
tctgcagtcccagagagctcacaggtcctgggtctcatccaacgccaagtcttattccag
cactgggctcgctggggcaagtggaacaagtaccagccattggaccatgtgcgaaggtac
ttcggggagaaggtggctctctacttcgcctggcttgggttttacactggttggctcctg
cctgcggcagtagtgggcacagtggtcttcctggtgggatgtttcctggtgttctcagac
ataccaacgcaggagctgtgtcacagctcagacagcttcgacatgtgcccgctgtgctcc
gactgttctttttggctgctctccagtgcctgcaccctggcccaggctgggcggctcttc
gaccatggcggcaccgtcttcttcagtttgttcatggcactgtgggcggtgctgcttctg
gagtactggaagcggaaaaacgccacattggcctaccgctgggactgttctgactatgaa
gacattgaggagaggcctcggccccagttcgctgcaacggcccccatgacagccctgaac
cccatcacgggggaagatgagccctactttcctgagaagaatcgtgtacgccgcatgctg
gctggttctgtggtgctcttgatgatggtggctgtggtgattatgtgccttgtatctgtc
atcctgtaccgggccgtcatggctatcattgtgtccaggtcagacaacgccttcctctct
gcctgggcttcacggattgccagcctcacagggtcagtggtgaaccttgtcttcatcctc
atcctctccaaggtctatgtgctcctggcccaggtcctaacaagatgggagatgcaccgg
acacagaccgagtttgaggatgccttcaccctcaaggtgttcatcttccagtttgtgaat
ttctacgcctcgcccgtgtatatcgccttcttcaagggcaggtttgtgggatacccgggc
aactaccacaccttgtttggaatccgaaatgaggagtgtccagctggaggctgcctcagt
gagctggcacaggagctcctggtcatcatggtgggcaagcagatcatcaataacgtgcag
gaggttcttgtcccaaagctgaaaggctgctggcagaagttctccaggggcaagaaggct
ggcacggggacccacccagcaccttgggaggccgactatgagttgctgccttgtgagggg
ctgtttcacgaataccttgaaatggtgctgcagtttggattcgtcaccatcttcgtagct
gcctgcccgctggcgccgctttttgccctactcaacaactgggtggagatccgcctagat
gcgcgcaagttcgtgtgcgagtatcggcgcccagtggcggagcgcgcccaggacatcggc
atctggttccacatcctaacgggcctcacacacctcgcggtcatcagcaatgccttcctg
ctggccttctcctccgacttcctgccacgtgtctactacagctggacgcacgcccctgac
ctgcatggcttcctcaatttcacgctggcacgagcaccgcccactttcacctccgcacac
aaccgcacttgcaggtaccgggctttccgggatgatgatggacactattctccgacttac
tggactctcctggccatccgcctggcctttgtcatcgtatttgagcatgtggtgttctcc
attggccgtgttctggatctcttggttcctgacatcccagaatccgtggagatcaaggtg
aagcgggaatactatttagctaaacaagcactggctgagaacgaggctctccttggagca
acaggagtgaaggatgaccaacctccaagttcagagcccagcctgggtcttccagcctaa

DBGET integrated database retrieval system