KEGG   Mus musculus (mouse): 407789Help
Entry
407789            CDS       T01002                                 

Definition
(RefSeq) cDNA sequence BC048644
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 407789
NCBI-ProteinID: NP_001028657
MGI: 3039566
UniProt: Q3V0I3
Position
8; 8 E1
AA seq 230 aa AA seqDB search
MLASHMMYAASYVTYGTSKYYHGALHSVTLMQTENPSSSSGTPQILQRGQGGMAQSVSCL
SLSLACMVVRSCNPSLACMVVRSCNPSLACMMVRSCNPSLACMVVRSCNPSLACMVVRSC
NPSLACMVVRSCNPRLACMMVRSCNPSLACMVVRSCNPSLACMVVRSCNPSLACMVVRSC
NPSLACMVVRSCNPSLACMVVRSCNPSLACMVVHSCNPSTGEAEPGEPGA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgctggcttcacacatgatgtatgccgcttcatacgtgacgtatggtacctcaaaatat
tatcatggggccttgcactcggtgactctcatgcaaacagaaaacccttctagcagttcg
ggaacacctcaaatactccagcggggccagggaggcatggcacagtcggtatcctgcttg
agtttgagcctagcatgcatggtggtgcgctcttgcaatcctagcttagcatgcatggtg
gtgcgctcttgcaatcccagcctagcatgcatgatggtgcgctcttgcaatcccagccta
gcatgcatggttgtgcgctcttgcaatcccagcctagcatgcatggtggtgcgctcttgc
aatcctagcctagcatgcatggttgtgcgctcttgcaatcccaggctagcatgcatgatg
gtgcgctcttgcaatcccagcctagcatgcatggttgtgcgctcttgcaatcccagccta
gcatgcatggtggtgcgctcttgcaatcccagcctagcatgcatggtggtgcgctcttgc
aatcccagcctagcatgcatggtggtgcgctcttgcaatcccagcctagcatgcatggtg
gtgcgctcttgcaatcccagcctagcatgcatggtggtgcactcttgcaatcccagcact
ggggaggcggagccaggggaacctggtgcttag

DBGET integrated database retrieval system