KEGG   Mus musculus (house mouse): 407821
Entry
407821            CDS       T01002                                 
Symbol
Znrf3, Gm1167
Name
(RefSeq) zinc and ring finger 3
  KO
K16273  E3 ubiquitin-protein ligase ZNRF3 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    407821 (Znrf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    407821 (Znrf3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     407821 (Znrf3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    407821 (Znrf3)
SSDB
Motif
Pfam: ZNRF_3_ecto zf-RING_11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-C3HC4_3 zf-rbx1 Cadherin_C_2
Other DBs
NCBI-GeneID: 407821
NCBI-ProteinID: NP_001074393
MGI: 3039616
Ensembl: ENSMUSG00000041961
UniProt: Q5SSZ7
Structure
Position
11:complement(5226329..5394847)
AA seq 913 aa
MRPRSGGRPGAPGRRRRRLRRGPRGRRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEV
VLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGV
VKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYV
KGADAIKLMNIVNKQKVARARIQHLPPRQPTEYFDMGIFLAFFVVVSLVCLILLVKIKLK
QRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCGALDTLSSGSTSDCAICLEKYIDG
EELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPGAVCVETSNLTRGRQPRVT
LPVHYPGRVHRTNAIPAYPTRTSMDSHGNPVTLLTMDRHGEQNLYSPQTPTYVRGYPPLH
LDHTLAPHRCSLEHRAYSPAHPFRRPKFSSRSFSKAACFSQYETMYQHYYFQGLSYPEQE
GQTIPSVTPRGQSRAFPPSGASSLLFPTMVHVAPPTHVESGSTSSFSCYHGHRSVCSGYL
ADCPGSDSSSNSSGQCRCSSSDSVVDCTEVSNQGVYGSCSTFRSSLSSDYDPFIYRSRGP
AVHLEGSPPPEELPAGHSQSAGRGEPWLGPASPSGDQLSTCSLEMNYSSNSSLEPRGPNS
STSEVGLEVSPGAALDLRRTWKGGPEGPSCACCFEPQPFPPGSGIETSAGGSSLFLGPRL
LEDCNPPSGEPQLGSSQGLYGLHSDHYPRTDGVKYEGLPCCFYEEKQVAHSAGRGNGCYT
EDYSVSVQYTLTEEPPPSCYAGPRDLSQRIPIIPEDVDCDLGLPQDCHGMHNHSPWGGAL
SLDVPRLHWSLGTTREEEQAPCYQAEVQPGCSPEEAGASRASLSSAPQDTQESHALAAEA
SGPGSGPGIGTGA
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgaggccacgctcgggcgggcgcccaggggccccgggccgccgccgccgccgcctccgc
cgcggcccccgcggtcgtcgcctgccgccgccgccgccgctgccgctgcttctcgggctg
ctgctggcggccgcggggcccggcgcggcgcgggccaaggagacggcgttcgtggaggtg
gtgctgttcgagtcgagcccgagcggcgactataccacccacaccaccggcctcacgggc
cgcttctcgcgggccggggccatgctcagcgccgagggcgagatcgtgcagatgcaccca
ctaggcctatgtaataacaatgacgaagaggacttgtatgaatatggctgggtaggagtg
gtgaagcttgaacagccagaattggaccccaaaccatgtctcactgtcctgggcaaggcc
aagagagcagttcagcggggagctactgcagttatctttgatgtatctgaaaatccagaa
gccatcgaccagctaaaccaaggctcagaagaccctcttaagaggccagtggtgtatgtg
aagggtgcagatgctatcaagctgatgaacattgtcaacaagcagaaagtagctcgagca
aggatccagcacctccctcctcgacaacccaccgagtactttgacatgggaattttcctg
gccttcttcgtcgtggtctccttggtctgcctcattctccttgtcaaaatcaagctgaag
caacgtcgtagtcagaattccatgaacaggctggctgtgcaggctctggagaagatggaa
accagaaagttcaactccaagagcaaggggcgccgggaaggaagctgtggggccctggac
acactgagcagcggctccacatccgactgtgccatctgtctggagaagtacattgacgga
gaggagcttcgggtcatcccttgtactcatcggttccacaggaagtgtgtggatccatgg
ctactgcagcaccacacctgcccccactgtcggcacaacatcatagaacaaaagggaaat
ccaggtgctgtttgtgtggagacaagcaaccttacacgtggtcggcagccaagagtgacc
ctaccggtacattacccaggccgtgtgcataggaccaatgccatcccagcctaccctact
aggacaagtatggactcccatggcaaccctgtcacactgctaaccatggaccggcatggg
gagcagaacctctattctccacaaacacccacctatgtccgtggctacccacccctgcac
ctggaccacactctggcccctcatcgctgcagcctggaacaccgggcctactcaccagcc
catcccttccgcaggcccaagttcagcagccgcagcttctccaaggcagcttgcttctcc
cagtatgagaccatgtaccaacactactacttccagggtctcagctacccagagcaggag
ggccagacaatacccagcgtcacacccaggggccaatcccgtgccttcccaccaagtggt
gccagcagcctgctcttccccacaatggtacatgtggcccctccaacccacgtggagagt
ggcagcacatctagcttcagttgctatcatgggcaccgttctgtgtgtagcggctacctg
gctgactgtcctggcagcgatagcagcagcaacagctctggccagtgccgctgctcttcc
agtgactccgtggtggactgcacagaagtcagcaaccaaggtgtgtatgggagctgttcc
accttccgaagctccctcagcagcgactatgaccccttcatctaccgcagccgggggcct
gctgtgcaccttgagggctcccctccaccagaggagctcccagcaggacacagtcaaagt
gctgggaggggcgagccatggctaggccctgcctctccctcaggggaccagctgtccacc
tgcagcctggagatgaactacagcagcaactcctcgctggaacccagagggcccaacagc
tctacctcagaagtggggctcgaggtttctcctggggctgccctggacctcaggaggacc
tggaaagggggtccagagggaccatcatgtgcttgctgcttcgagccccagcccttcccg
ccgggctctgggatagaaacaagtgcaggtggcagcagtttattcctgggtcctcggctc
ctcgaggactgcaaccctccaagtggggagccacagctggggagctcccagggcctgtat
ggtcttcactcagaccattatcctaggacagatggggtgaaatatgagggcttgccctgc
tgcttctatgaagagaagcaggtggcccacagtgctggcaggggcaatggctgctacact
gaggactattcagtgagtgtacagtacacactcaccgaggaacccccacccagctgttat
gcagggccccgggacctgagccagcgcatccccattattccagaggatgtagactgtgac
ttgggcttgccccaagactgccacgggatgcacaaccacagcccctggggtggggcactg
agcttggacgttccccgactccactggagtctaggcacaacccgggaagaggaacaggct
ccatgttaccaagctgaggtgcagcctggctgctctccagaggaggcaggtgcttccagg
gctagcctctccagtgccccccaggacactcaggagtctcatgccctggctgctgaggct
tcaggaccaggatctggcccaggcatcggtacgggagcttga

DBGET integrated database retrieval system