KEGG   Mus musculus (house mouse): 408022
Entry
408022            CDS       T01002                                 
Symbol
Primpol, Ccdc111
Name
(RefSeq) primase and polymerase (DNA-directed)
  KO
K22761  DNA-directed primase/polymerase protein [EC:2.7.7.102 2.7.7.7]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    408022 (Primpol)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    408022 (Primpol)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     408022 (Primpol)
    2.7.7.102  DNA primase AEP
     408022 (Primpol)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   DNA polymerases
    408022 (Primpol)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA polymerase
    408022 (Primpol)
SSDB
Motif
Pfam: Herpes_UL52 DNA_primase_S
Other DBs
NCBI-GeneID: 408022
NCBI-ProteinID: NP_001001184
MGI: 3603756
Ensembl: ENSMUSG00000038225
Position
8:complement(47028614..47070282)
AA seq 537 aa
MLRKWEARVKQIEERASHYERKPLSSVYRPRLAKPEEPSSIWKLFHRQNQAFNFVKSCKE
SVHVFALECKRGNGQRIYLVTSYAQLWFYYKTRKTLLHCYEVIPENAVCKLYFDLEFNKL
ANPGADGKMMVALLIQHVCKALEEFYNVQCSAEDVFNLDSSTEEKFSRHLIFQLHNVAFK
DNRHAGNFVRKILQPALHLIAEDDEAKVPEAVGQDASGFSVTPLKQEISEAREKVGLPKQ
CDPDLSFLVVKNHMGEKCLFVDLGVYTKNRNFRLYQSSKIGKCVSLEVAEDNRFIPKQSK
DISEENQYFLSSLVSNVRFSDTLRVLTCHPSQTKRKRAECFNSTGTSVESIEGFQGSPYP
EVDQFVLSLVNKHDIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLK
NEVWYQKCHDPVCKAQNFKSTCSPLPTEVSLLFLLKDEDFTSGETDDTSTSLTKDSQTPP
SCNLSAGGLSAAAWDDEDDALFLEATEDAEFADAADKSLGSMDDIPDELIIEALQNS
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgttgaggaaatgggaggcaagggtgaagcagattgaagagcgggcatcccactatgag
aggaagccattgtcttccgtgtacagaccaagactggccaagccagaagaaccatcctcc
atttggaagctatttcaccgtcagaatcaagcttttaattttgttaaaagctgtaaagag
agcgttcacgtatttgctttggagtgcaaaaggggaaatggacaacgtatttaccttgta
acgtcctatgcccaactttggttttactataagacccggaaaaccctcttgcactgctat
gaagttattcctgagaatgctgtgtgcaagctttattttgatttagaatttaacaaattg
gccaacccaggagctgatgggaagatgatggttgcattgctcatacagcatgtttgtaaa
gcacttgaggagttttacaatgttcagtgctcagccgaagatgttttcaacctggattcc
agcactgaagagaaatttagccgacacctaatatttcagctccacaatgtggcatttaaa
gataacaggcatgctggtaattttgtgagaaaaattttgcaacctgctcttcacttgatt
gccgaggatgatgaagctaaggtcccagaggcggtgggccaggacgcctccggtttttct
gttacaccattaaaacaagagatttcagaggcccgggagaaggtggggttgcctaagcag
tgtgaccccgatctttcatttttagttgtgaaaaatcacatgggagaaaaatgccttttt
gtggatctaggagtgtatacaaaaaacagaaactttcgactgtatcagtcatccaaaata
ggaaagtgtgtgtctttggaggttgctgaagataacagatttattccaaaacagtcaaaa
gatatttctgaggaaaaccagtatttcctatcttccctggtgagcaatgtcagattctca
gatactctgcgagttctcacatgccacccatctcagactaaacgaaagcgggctgagtgt
tttaacagtactggcacttcagtggagtccattgaaggcttccagggctccccataccct
gaggttgaccaatttgttctttctttggtgaacaaacatgacattaaaggagggattcgg
cgttggaactactttttcccggaagaattactggtttatgatatatgcaaataccgctgg
tgtgaaaacattggaagagcccacaagagtaataatataatgattctggttgatctgaag
aatgaagtttggtatcagaaatgccatgaccctgtctgtaaagcacaaaacttcaaatct
acctgttccccattacccactgaagtaagtctgctatttcttctgaaagatgaagacttc
acttctggagaaacagatgacaccagcacctcactgaccaaggattctcaaaccccgcca
tcctgcaacttgtcagccggcgggctttctgccgctgcctgggatgacgaagatgacgcc
cttttcttagaagcgacagaagatgctgaatttgctgacgctgcagataagagccttggt
tcaatggatgatattcctgatgaactaattatagaagctttacagaatagctga

DBGET integrated database retrieval system