KEGG   Mus musculus (house mouse): 408066
Entry
408066            CDS       T01002                                 
Symbol
Cspg4b
Name
(RefSeq) chondroitin sulfate proteoglycan 4B
  KO
K08115  chondroitin sulfate proteoglycan 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    408066 (Cspg4b)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   408066 (Cspg4b)
SSDB
Motif
Pfam: Cadherin_3 Laminin_G_2 Laminin_G_1 Cadherin_4
Other DBs
NCBI-GeneID: 408066
NCBI-ProteinID: NP_001365627
MGI: 3040697
Ensembl: ENSMUSG00000021763
Position
13:113429570..113507049
AA seq 2391 aa
MGRPGACGLLLLTAFLGLCGPRGGLGASFYGESYVGLSTTEVFPELSLQLRFQTSKPQGL
LFLAAGKTDYCLIELLSGILQVKINMGTGQEILLSEQRLRVDDLAWHSLELRYGKDAVLL
VIDKHFETTVRLAGGLRNFTFHHGIYIGGRGGLSVPYLDRKIPNFRGCMEDVAFNQREIL
TSLRSYPGFKKVSEVSLGCNDEFFAGKDEAISFFSSRSYVTFPEWKVHGEGFLRFAVQTG
TLQALLLFQSGRGRDFVALEIHEGLLKAHVGRGGTKTQLSSFSLVSDNKWHVVQLKVTGR
HVDIMVDEHRERAGLPLQSQAFVSEGPLFMGGLDDRMWETVRGLEVVSMPGKSVRGMSLK
GCLRALEANLEKRALRDALVSRDISAGCTSEGLRGTDPSVAGEDLFPPEPSSPTTIPSSP
LKIQSGSFLVLNKLEVQEGGRALLGQRHIEVDVDFMDLGINSSQILFKIQEMPAHGFLQI
DAWPAQEMERTFTLSDLRHGKVWYVHDGSEEPTDSFTFWAFSSSKQALLSQLQAPVPHVF
NITVLPVNDPPYLKLPEGHLLLFENTKQRLTPRVIQVLDPDTDSRRLRFSVLNNFNSEAG
FLENAREPGRAITGFTDMDLQDGNIFYVHRGPRNSRVALRATDGELVSNTVVLRVMAVPW
DFEVADRTGVVVPQGGTILITRNNLSVKVNGGQHELDTLYDITHPPQFGQIQHRGSNGEW
KPVRTFSQRSIDQSQIRYYSSFKGLQQENVTDHFKFRVNIEGRVGRELLFPVTVQWLQLT
LLKNIPLEISNANKKVLDSGHLQAAAGSVAAPERGLHFKLLIPPKRGRLLLGNKVLKSGS
MFSQKNIADSKVSYEPQGMPGQDSQDSFSFSIVVKQVESKDHTFRIDLKADKTHVTITNT
GLYVKEGERTIITKSELFVQTLDNHVFQYKVTKSPQHGELKLVSSSASLGSDNRATGFTD
EDIVSGRLVYVHDDSEAQWDEFILLASATGLGQQGGVRSLDSEHTSTEIKVSVSVELKND
EKPVRVVDKIFHVVRDSQRLLTLADLCYHDPDIDFDDGQLLYTRHGIPNGDLVKAADPIR
KLYQFRQEDLREGRVLFRHHGPDFARFLIFVTDGVHYTSSLFEVSVSEAYVRIVNNTGLL
VHRGRDSFLTTANLSVTTNQDVRTDHEFEFHIVQPPKHGRLLVNNSTFHSFSQHDLKQGR
VIYRYDGDGNLDIFNLTVKVKDAYLDVSIRVQVSSEGRQRSTPILHSRSLIVEEGKPVKL
SRGKLQAGNEEDIPSEAVFTVRTPPVHGYLQISTAEDGIAGADVMPTLNFTQQDVDDGHV
LYVQTAPGQQKDQFTLDVTKDSRVIRRVEVLLEPIPKWIPLKVQNLTVQEGGSKVLLQDH
LQIASKYLEGLDCEFILLEPPKHGYVESSKFPRVKLMKFSRREVAQELIYYVHDGSEEFL
DSLTILANSSELGKQSPPQTLFVTVESVNDEAPVVTANNILQVWVNSVTEVTRGDLCAGD
GDSSPQDLVYWVTPPSNGHLALKSTPGRRIQNFTQAQIDEGQLVFVHTGAMSGGFNFQVT
DGLNFAPRQIFSITARALIISLEVNRGLSIFPGSTKPLSSHDLRAVTNDDKAGNRTVTFT
VVRSPKLGRLLKMNPDNRTEDVSTFTQCLVSEGLILYQHVDLESTGWASEDSFTFTASSP
PAELGPEAFRITISYEVNESGRQSRLRANTGASVKEGDKVLIDQSKLDASNLLLQLPQPQ
RSSHEIWFQVTALPHHGTIMVGERNITTGRPYFSQHTVNVFGAAYLHDDSESLADNFTFA
VWPNPKNKSTSKPEAGFLEEMFNITITPVNDQPPELKTKGLRLTVLQGDRLVVGPEILNV
EDIDSPPNEIQYEIIRHPNNGFLAMAHDPDATAHHFTQADINNAQVWFIQDRSPSSGVFY
FSVTDGKHRPLYKLFHLDVTPISITLVNLTDLLLPQGQNTVPITNTHLSAVTNGRSLQII
YRMTQPLQSGHLLIENQVVNSFGQEDLDSGRLSYHMTNLTASEDQLRVSLFTTECNLTEQ
TLNIRVQPLLWVIANLKVTNRVAHQLRTEDLDATELANRTNSDPMFEVIQPLVHGRLVRR
AVDSPVMEEITQFTQTDINQGQLVLEPHANLTGTHTLNDSFTFLLSADHVQPAAGYLAFT
IVPPDPLPLQTFTPDVPLFVTGETLVASVSSQKKLRASIKKQTETPGNLTQGRWQGTDSW
GQLSGKEPNIDAKVSPTRVIWPYAATKVGESLSGGAMQPEMSRHPLVVIIPLAAVFLLLL
VTVVALCVWLLSRKEDKPKPLTQPKTNLKSPSTGSRAERSGAIPTVTVTPLIRSSLAPSL
FQTQSYDRPAPLGAEPVEKCAPWDAWVNLDPDMAKLCRQTNPALKHNQYWV
NT seq 7176 nt   +upstreamnt  +downstreamnt
atggggcggcccggggcctgcggcctcctgttgctcaccgcctttctggggctctgcggg
ccgcgcggggggctcggagcatctttttatggggaaagctacgtggggctcagcaccacc
gaggttttccctgagctgtcgcttcagttaagatttcaaaccagcaagccacaaggctta
ctcttccttgcagccgggaaaaccgactattgcctgatagaacttctgtcaggaatatta
caggtgaaaataaacatgggtacggggcaagaaatcctcctttctgagcaaagacttcgt
gtggacgatttggcttggcattcgttggagctgcgctatggcaaggatgctgttctcttg
gtcattgacaagcactttgagacaaccgtccggctggcgggtgggctgcgtaacttcacc
tttcaccatggaatctatataggaggccgtggggggctcagtgtcccttacctggacagg
aagatccccaacttccggggatgcatggaggatgtggcgtttaaccagagggagatcctt
acgtcccttaggtcataccctggctttaagaaggtgtctgaggtgtcgctggggtgtaac
gatgagttttttgctgggaaggatgaagctattagctttttcagctctaggtcctatgtt
acctttccagaatggaaggtacacggggaagggttcctgagatttgctgtgcaaactgga
accctgcaggctttgcttttatttcagtccggcagaggaagagattttgttgccttggaa
atccatgagggtctactgaaggctcacgtaggaaggggcggaacaaaaactcaactctct
tcattcagcttggttagtgacaacaagtggcacgttgttcagcttaaagtcaccgggagg
cacgtggacatcatggtggatgaacacagggaaagggcggggctgcctctgcaaagccaa
gcgtttgtatccgaaggccccctgttcatgggtggcctggatgaccggatgtgggaaact
gtgcgcggcttagaagttgtgtctatgcctgggaaatctgttcgaggtatgtctctgaaa
ggatgcctgcgagccttagaagccaatttggaaaagagagcattacgggatgctcttgtc
tccagagacatttcggctgggtgcacaagtgagggtctccgtggtacagatccttctgtg
gcaggggaagacctgtttccaccagagccatcctctcccacgaccattcccagttctcct
ctgaaaattcaaagtggcagctttttggttttgaataagttagaagtccaagaaggtgga
cgggccttactgggacaaaggcatatagaagtagatgtggactttatggatctgggtatc
aattcttctcagatactgtttaagatacaggaaatgccagctcatgggttccttcaaata
gatgcttggcctgcacaggaaatggagaggacttttactctgtcagatttgaggcatggg
aaagtgtggtatgtccacgatggttcagaagagcctacagattcgtttacgttttgggct
ttttctagtagcaagcaggcactgctgtcccagctgcaggctcctgttccacatgtgttt
aacattactgtccttccagtgaatgaccccccatatcttaagcttccagaaggacacctg
cttctctttgagaacactaagcaacgactaacacccagggtgatacaggtgttagatccc
gacaccgattctcggcggctcaggttttctgttcttaacaacttcaattcagaggctggg
tttttagaaaatgccagggagcccgggagagccatcactggttttacagacatggattta
caagatggcaacattttctatgtgcacaggggtcctcgaaactctcgagttgctctaaga
gcaactgatggtgagctggttagcaatactgtggtgttgcgggtcatggctgtcccttgg
gactttgaagtggctgataggactggcgtggtggtaccacaaggtggtaccattctcatc
actcggaacaacttgtctgtgaaggtgaatggtggacaacatgagctggacactctctat
gacatcacacatccacctcagtttggccaaattcagcaccggggatccaacggagagtgg
aaaccagttaggaccttttctcaacgttccattgaccagagtcagatccgatactatagt
tcattcaagggattgcagcaagaaaatgtgacggatcactttaagtttagagttaacata
gagggaagagtaggcagagagctcctgttccctgtgactgtgcagtggctgcagttgaca
cttctgaaaaatattcctctagagattagcaacgcaaacaagaaagtattggattctggc
catctgcaggctgcagcagggagtgtggcagcacctgagaggggactccatttcaagcta
ctgattccacctaagagaggaagactgctacttggcaataaagttcttaaatccggttca
atgttcagtcaaaaaaacattgcagactctaaggtgagctatgaacctcaggggatgcct
gggcaagactcacaggattcttttagtttctcaattgttgtaaaacaggtagaatctaaa
gatcacacctttaggatagaccttaaagcagataagacacatgtcactataaccaacact
ggactgtatgttaaagagggggaaaggacaataattacaaaatcagaattatttgttcaa
acactggataatcatgtcttccaatataaagtcaccaagagtcctcagcatggggaactg
aaattggtcagctcgtctgcttctctgggaagtgacaatagggccactggattcacagac
gaagacatagtgagtgggaggctggtctatgttcatgatgactctgaggcccagtgggat
gaattcatccttctggcctctgccacaggtctgggccaacagggaggggtcagaagtctt
gactctgagcacacgtctacagagatcaaagtcagcgtttctgttgagttgaagaatgat
gagaagccggtgcgtgtggtggataagatctttcacgttgtgcgggacagccagcgctta
ctgacactagcagatctctgttaccatgaccccgacatagattttgacgatggccagttg
ctctacactcggcatggcatacccaatggagatttggtgaaagctgctgacccaattcgg
aagctctaccagttcagacaagaggacctacgggaagggcgtgtgctcttcaggcaccac
ggtccagatttcgctcggttcctgatttttgtgacagatggtgtccattacacatcatcc
cttttcgaggtcagtgtgtcagaggcctatgtccgcatagtcaacaacacagggctgctt
gtgcacagagggagggacagctttctaacaacagccaacctgagcgtcaccacaaaccaa
gatgtcagaacagaccatgagtttgaattccacatcgtgcaacccccaaaacatggcaga
ctcctggtcaacaattctacctttcactcattttcccagcatgacctaaagcagggacgt
gtgatttataggtatgacggggatggcaacctcgatatctttaacctgacagtgaaagtt
aaagatgcctacctagatgtgagcatcagggtccaagtgtcgtcagaaggtcgccaacgt
tccactccgattctgcacagcaggagccttatagttgaagaaggaaaaccagtaaaactg
agcagaggaaagctccaggctgggaatgaagaagatattccttcagaggcagtgttcaca
gtcagaactccacccgtacacggatacctccaaatatccacagcagaagacggcatcgcg
ggtgcagatgtgatgcccactctgaacttcacccagcaagatgttgatgatggccatgtc
ctctatgtccagacagctcccggccagcaaaaggaccagttcaccctcgatgtgacaaag
gactcccgggttataaggagagtggaggtgctcttggagcccatccccaagtggattcct
ctcaaggtgcagaatctcacagttcaagaagggggctccaaggtacttctgcaggatcac
ctccaaattgcaagcaagtatttggagggtcttgactgtgaattcattctcctcgaaccg
ccaaagcacggttatgtcgaaagctccaagtttccaagagtgaagctaatgaaattttcc
aggagagaggtggcgcaggagttgatttactatgttcatgacggcagtgaggagtttctc
gacagcctcaccatcctggcgaacagctctgagcttggcaagcagagtccacctcagacc
ctgtttgtgactgttgagtctgtgaacgacgaggctccagtagtaacagccaataacatc
ctccaggtgtgggtgaattctgtcactgaggtgaccagaggggacctgtgtgcaggagat
ggggactcttccccacaggacttggtctactgggtcactcctcccagcaacgggcatctg
gctctcaagtccactcctggcagaaggatccagaacttcactcaggctcagattgacgag
ggtcagctggtgttcgtgcacactggagcaatgtcaggtggctttaatttccaggtgact
gacggtctgaattttgcgcctcggcaaatctttagcatcactgcccgagctctgatcatt
agcttagaagtcaacagaggattgagcatcttcccaggttccacaaagccactttcgtct
catgacctgagagccgtgaccaatgatgacaaggcaggaaacagaactgtaacatttaca
gttgtcaggtcccctaaactcgggaggctgctgaagatgaacccggataaccgcacagag
gatgtttccacttttacccaatgtctggtgagcgaagggctgatactctaccagcatgtg
gatcttgagagcacggggtgggcctcagaagactccttcacattcacagcatcttcccct
ccagcggagctgggccccgaggcttttcggatcaccatttcatatgaagtgaatgagtca
ggtcgacagagccggctgcgtgcaaatacaggagcctctgtcaaggagggagataaagtt
ctcattgaccaatcaaaattagatgcctccaacctcttacttcagctaccccaacctcag
cgttcttcccatgaaatctggttccaggttacggctcttcctcaccatggaaccattatg
gttggagagagaaacattaccacagggagaccctacttctcccagcacacagttaatgta
tttggagccgcgtatcttcatgacgactccgaatcactggctgataattttacctttgct
gtttggccaaacccaaagaataagtccaccagcaagccagaggctggctttctggaagag
atgttcaacatcaccatcacccctgtgaatgatcagcctccagaattaaagaccaaaggg
ctgcggttgacagttctgcagggcgataggttggttgtgggacctgaaatcctcaatgta
gaagatatagatagtcctccaaatgaaatccaatatgagatcatccgtcatcccaacaat
ggcttcttagccatggctcacgatccagatgccactgctcaccattttacacaggcggac
atcaataacgctcaggtgtggttcatacaagatagaagcccatcctcgggagtgttttat
tttagtgtgactgacggcaaacaccgccctctctacaagctcttccacctggatgtcacc
cccatttccatcactcttgtgaacctcacagacctgcttctcccacaaggccagaacact
gtccccatcaccaatactcatctctcagcagtgaccaatggtaggagcctccagatcatc
tacagaatgacacagcccctccaaagcggccacttgctgattgaaaaccaggtggtcaac
agctttgggcaggaggatttggattctggaagactctcttaccacatgaccaatctcaca
gcctccgaagatcagctgagggtctcactgtttacaacggagtgcaacttgacggagcag
acactgaacatcagggtgcagcctttgttgtgggttatagcaaacttgaaagtgaccaac
agagtggctcaccagcttaggacagaggatctagatgcaaccgagcttgctaacaggact
aatagtgatcccatgtttgaagtgatacaacccctagtccatggacgactcgttcgaaga
gcagttgatagccctgtgatggaagaaatcactcagttcacccagacagacatcaaccaa
gggcagctggtgcttgagccacatgctaatctaacaggcacccacacactgaatgactcc
ttcaccttcttgctcagtgcagaccatgtgcagccagcagcaggttatctagcctttacc
atagtgccaccagaccccttacctttacagacatttacaccagatgtgcctttatttgtc
actggagagaccctcgtggcctctgtttcctctcagaaaaaacttagggcttctattaaa
aaacagacagaaactccggggaatctgacccagggcagatggcaggggacagattcctgg
ggtcaactcagtggcaaagagccaaatatagatgccaaggtctctcccaccagggtcatt
tggccatatgctgccaccaaagtgggggagtccctttccgggggagccatgcagccggaa
atgagccgtcaccctctggtggtcatcatacctttggctgctgtgttcctcctcctgctg
gtgactgtggtggccctgtgtgtttggctactgagccgaaaggaggacaaacccaaacca
cttacccagccaaagacaaacctgaagtccccatccacaggctctagagcagagaggagt
ggagccattcccacggtcacggtgacaccccttattagaagcagcctggctcctagtctg
ttccagacccaatcctatgatcggccagcccctctgggggcggagcctgtggagaaatgt
gctccttgggacgcatgggtgaacttggatcctgacatggccaagctctgtcgacaaacc
aaccccgcactgaaacacaaccagtactgggtataa

DBGET integrated database retrieval system