KEGG   Mus musculus (mouse): 408190
Entry
408190            CDS       T01002                                 

Gene name
Wfdc13, Wfdc13l1
Definition
(RefSeq) WAP four-disulfide core domain 13
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 408190
NCBI-ProteinID: NP_001012722
MGI: 3582777
Ensembl: ENSMUSG00000067704
Vega: OTTMUSG00000016291
UniProt: Q5DQQ6
Position
2 H3; 2
AA seq 81 aa
MRPVSPLQLLLVLSLAPQPVLGSPKQYFLKYILEPPPCRSEPGACNMFCTQQEECPEPLQ
CCSAYCGIVCTSNQAPVLGLS
NT seq 246 nt   +upstreamnt  +downstreamnt
atgagacctgtgtcacctttgcagctcctgctggtgctcagcctagcaccacagccagtg
cttggaagtcccaagcaatactttctgaagtacatcctggaacctccaccgtgcagatcg
gagcccggagcgtgcaacatgttctgtacgcagcaggaggaatgccctgaaccgcttcag
tgctgttccgcctactgtgggatagtgtgtacctcaaaccaagccccagtactagggctc
tcctaa

DBGET integrated database retrieval system