KEGG   Mus musculus (house mouse): 432450
Entry
432450            CDS       T01002                                 
Symbol
Nkain2, 6330571D19Rik, AW455467, Tcba1
Name
(RefSeq) Na+/K+ transporting ATPase interacting 2
  KO
K22735  sodium/potassium-transporting ATPase subunit beta-1-interacting protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    432450 (Nkain2)
Transporters [BR:mmu02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   432450 (Nkain2)
SSDB
Motif
Pfam: NKAIN
Other DBs
NCBI-GeneID: 432450
NCBI-ProteinID: NP_001013429
MGI: 1923447
Ensembl: ENSMUSG00000069670
UniProt: Q4PNJ2
Position
10:complement(31565314..32773170)
AA seq 208 aa
MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR
YVTGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCMVTSV
TPAPDWAPEDHRYITVSGCFLDYQYIEVAHSSLQIVLALAGFIYACYVVRCITEEEDSFD
FIGGFDSYGYQGPQKTSHLQLQPMYMSK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgggttattgcagtggcaggtgcacgcttatctttatctgtggcatgcaactggtttgt
gtgctagagaggcaaatatttgatttccttggatatcagtgggcacctatcctggcaaat
tttgtacatataatcatcgtcatccttgggttgtttggaactattcaatatagacctcgt
tacgtaacaggatatgctgtctggctagttctctgggtgacctggaatgtatttgttatc
tgcttctatttggaggctggagatctctcaaaggaaacagaccttatcctgacatttaat
atttcaatgcaccgatcttggtggatggagaatggaccaggatgtatggtgacgtctgtg
acacctgccccagactgggctccagaagaccatcgctacatcactgtctcagggtgtttt
ctggactaccaatacatagaagtggctcatagttccctccagattgtcctcgcactggcg
ggcttcatctatgcctgttatgttgtgagatgtataactgaagaagaggacagctttgac
ttcataggtggctttgattcttatggataccaagggcctcagaagacatctcacttacaa
cttcaaccaatgtacatgtcaaaataa

DBGET integrated database retrieval system