KEGG   Mus musculus (mouse): 432516Help
Entry
432516            CDS       T01002                                 

Gene name
Myo1a, BBM-I, Myhl
Definition
(RefSeq) myosin IA
  KO
K10356  myosin I
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    432516 (Myo1a)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    432516 (Myo1a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    432516 (Myo1a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    432516 (Myo1a)
   04147 Exosome [BR:mmu04147]
    432516 (Myo1a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     432516 (Myo1a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Others
    432516 (Myo1a)
 Others
  Actin-binding proteins
   Myosins
    432516 (Myo1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    432516 (Myo1a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     432516 (Myo1a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   432516 (Myo1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_TH1 IQ AAA_16 AAA_22 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 432516
NCBI-ProteinID: NP_001074688
MGI: 107732
Ensembl: ENSMUSG00000025401
UniProt: O88329
Position
10 D3; 10 74.62 cM
AA seq 1043 aa AA seqDB search
MPLLEGPVGVEDLILLEPLDEESLIKNLQLRYENKEIYTYIGNVVISMNPYEQLPIYGPE
FIAKYRDYTFYELKPHIYALANVAYQSLKDRDRDQCILITGESGAGKTEASKLVMSYVAA
VCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITN
YLLEKSRVVKQLKGERNFHIFYQLLAGADAQLLKALKLEEDTSVYGYLNGEVSKVNGMDD
ASNFRAVQHAMSVIGFSEEEIRQVLEVTALVLKLGNVKLTDEFQANGIPASGICDGKGIQ
EIGEMMGLNSTELERALCSRTMETGKEKVVTVLNVTQAQYARDALAKNIYSRLFDWIVKR
INESIKVGTGEKKKVMGVLDIYGFEILEDNSFEQFVINYCNERLQQVFIELTLKEEQEEY
KREGIPWTKVEYFDNGIICNLIEHSQRGILAMLDEECLRPGVVSDSTFLAKLNQLFSKHS
HYESKVSQNAQRQYDRTMGLSCFRISHYAGKVTYNVTGFIDKNNDLLFRDLSQTMWKAQH
PLLKSLFPEGNPKEASLKRPPTAGTQFKNSVAVLMKNLYSKNPNYIRCIKPNDQQQKGRF
TSEMVMVQARYLGLLENVRVRRAGYAFRQGYKPFLERYRLLSRSTWPRWNGDDREGVEKV
LGSLTLSSEELAYGKTKIFIRSPKTLFYLEEQRRLRLQQLATLIQKVYRGWRCRTHYQQM
RKSQILISAWFRGNKQKKHYGKIRSSVLLIQAFVRGWRARKNYRKYFRSGAALTLANFIY
QSMAQKFLLNLKKNLPSTKVLDNTWPAAPYRCFNTANQELQRLFYQWKCKKFRDQLSPKQ
VQTLREKLCASELFKGKKASYPQSVPIPFRGDYIGLQGNPKLQRLKGREEGPVLVADTVK
KVNRGNGKTSARILLLTKGHVILTDAKKSQAQIVIGLEDVAGVSVSSLQDGLFSLHLSEM
SSAVSKGDILLVSDHVVELLTKMYQAVLDATQRQLSVTVTEKFSVRFKEGSVAVKVIQGP
EGGGNRKLICKKKGSNAMEVTVR
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcctggaaggtcccgtgggggtggaagacctcatcctcctggagcccctagat
gaggagtctctgatcaagaacctccaactccgttatgaaaacaaagagatttatacatac
attgggaatgtggtgatctcaatgaacccctacgagcagcttcccatctatggaccagag
ttcattgccaaataccgggactatactttctatgagctgaagcctcacatctatgctttg
gcaaatgtggcctaccagtcactgaaggatcgggaccgggaccagtgtatcctcatcaca
ggcgagagtggagctggcaagactgaggcgagtaagctagtgatgtcctacgtggctgct
gtctgtgggaaaggagagcaggtgaactctgtgaaggagcagctgcttcagtcaaaccca
gtgctggaagcatttggcaatgccaagaccatccgcaataacaactcctctcgatttgga
aagtacatggacatcgagtttgacttcaaagggtcccccctgggcggtgtcatcaccaac
tatctgcttgagaagtcccgagtggtgaagcaactcaaaggggagaggaatttccatatc
ttctatcaactgctggctggagcagacgcacagctgctgaaggccctaaagcttgaggag
gacacgagtgtatacggctacctgaatggggaggtgtccaaggtgaacggtatggacgac
gcctccaacttcagggctgtgcagcatgcgatgtcagtgattggcttctcagaggaggaa
attagacaagtgctggaggtgacagccctggtgctgaagctggggaacgtgaagctgaca
gacgagttccaggccaatgggatcccagccagtggcatctgtgatgggaaaggtattcag
gagattggggagatgatgggcttgaactctacggaactagagagagcgctgtgctcaaga
actatggagacaggcaaagagaaggtggtcacggtgctgaatgtcacacaggctcaatat
gctcgggatgccctggcaaagaatatttacagccgcctcttcgactggatagtgaaacgc
atcaacgagagcatcaaggtgggcactggggagaagaagaaggttatgggggtcctggat
atctacggctttgagatattggaggataacagctttgagcagttcgtgatcaactactgc
aatgagaggctacagcaggtgttcatagaactgaccctgaaggaagaacaggaggaatac
aagagagaaggcataccgtggacaaaggtggaatactttgacaacggcatcatctgtaac
ctcattgaacatagtcagcgaggtatcctggccatgctggacgaggagtgcctgagaccc
ggggtggttagtgactccaccttcttagcgaagctgaaccagctcttctctaagcacagt
cactacgagagtaaagtctcccagaatgcccagcgccagtacgaccgcaccatgggcctc
agctgcttccgcatcagccactacgcgggcaaggtgacctacaacgtgaccggcttcatc
gacaagaataacgacctactcttccgagacctatcccagacaatgtggaaggcccagcat
cccctcctgaagtccttgtttccagaggggaaccccaaggaagcgtctctcaaacgaccc
ccgactgccgggacccagtttaagaattcggtggctgtactcatgaagaacctgtattct
aagaaccccaactacatcaggtgcataaagcccaatgaccagcagcagaaaggcaggttc
acctcagagatggttatggtccaggcgcgatacctggggctgctggagaatgttcgggtg
cgcagggctggctatgccttccgccagggctataagcctttcctggaaaggtaccgattg
ctgagccggagcacctggcctcgctggaatggggatgatcgggaaggtgtggagaaggta
ctcgggtctctgactttgtcctcagaggagctggcctacgggaagacaaagatcttcatc
agaagccccaaaactcttttctacctggaagaacaaaggcgcctgaggcttcagcagctg
gccaccctcatacagaaggtctaccgcggctggcgctgtcggacccactaccagcagatg
cggaagagccaaatcctcatctcggcttggtttcggggcaacaagcaaaagaagcactat
gggaagatacggtcgtcagtgctgctgatccaggctttcgtgaggggctggagggcccgc
aagaactatcgaaaatacttccggtcaggtgctgccctcaccttggcaaattttatctac
cagagcatggcacagaaattcctcttgaatctgaagaagaatttgccatccaccaaagtg
ttggacaacacatggccagccgccccttacaggtgcttcaacacagccaatcaggagctg
cagcgcctcttctaccagtggaagtgcaagaagttccgagatcagctgtccccgaagcag
gtgcagacactgcgggaaaagctctgtgccagtgaactgtttaagggcaagaaggcttcc
tacccccagagtgtgcctatcccgttccgtggtgattacatcgggctgcaagggaacccc
aagctgcagagactgaagggcagggaggaggggcctgtcctggtggcagacaccgtgaag
aaggtcaaccgtggcaatggcaagacatcggcgcggattctcctcctgaccaaggggcac
gtgattctcacggatgcgaagaagtcccaggcccagattgtcataggactggaggatgtg
gctggggtgtcagtcagcagcctccaggacgggctctttagcttgcatctgagtgagatg
tcatcggcagtctccaagggggacatcctgctagtgagcgaccatgtggttgaactgctg
acaaaaatgtaccaagcagtgttggatgccacacagaggcagctctctgtcactgtgact
gagaagttctcagtgaggttcaaggagggcagtgtggctgtcaaggttatccagggcccc
gaggggggtgggaacagaaaactgatttgcaagaagaaggggagtaatgccatggaggtg
actgtgcggtga

DBGET integrated database retrieval system