KEGG   Mus musculus (mouse): 432530
Entry
432530            CDS       T01002                                 

Gene name
Adcy1, AC, AC1, D11Bwg1392e, I-, I-AC, brl
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05142  Chagas disease
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    432530 (Adcy1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    432530 (Adcy1)
   04371 Apelin signaling pathway
    432530 (Adcy1)
   04020 Calcium signaling pathway
    432530 (Adcy1)
   04072 Phospholipase D signaling pathway
    432530 (Adcy1)
   04024 cAMP signaling pathway
    432530 (Adcy1)
   04022 cGMP-PKG signaling pathway
    432530 (Adcy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    432530 (Adcy1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    432530 (Adcy1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    432530 (Adcy1)
   04062 Chemokine signaling pathway
    432530 (Adcy1)
  09152 Endocrine system
   04911 Insulin secretion
    432530 (Adcy1)
   04923 Regulation of lipolysis in adipocytes
    432530 (Adcy1)
   04912 GnRH signaling pathway
    432530 (Adcy1)
   04913 Ovarian steroidogenesis
    432530 (Adcy1)
   04915 Estrogen signaling pathway
    432530 (Adcy1)
   04914 Progesterone-mediated oocyte maturation
    432530 (Adcy1)
   04921 Oxytocin signaling pathway
    432530 (Adcy1)
   04926 Relaxin signaling pathway
    432530 (Adcy1)
   04935 Growth hormone synthesis, secretion and action
    432530 (Adcy1)
   04918 Thyroid hormone synthesis
    432530 (Adcy1)
   04928 Parathyroid hormone synthesis, secretion and action
    432530 (Adcy1)
   04916 Melanogenesis
    432530 (Adcy1)
   04925 Aldosterone synthesis and secretion
    432530 (Adcy1)
   04927 Cortisol synthesis and secretion
    432530 (Adcy1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    432530 (Adcy1)
   04270 Vascular smooth muscle contraction
    432530 (Adcy1)
  09154 Digestive system
   04970 Salivary secretion
    432530 (Adcy1)
   04971 Gastric acid secretion
    432530 (Adcy1)
   04972 Pancreatic secretion
    432530 (Adcy1)
   04976 Bile secretion
    432530 (Adcy1)
  09156 Nervous system
   04724 Glutamatergic synapse
    432530 (Adcy1)
   04727 GABAergic synapse
    432530 (Adcy1)
   04725 Cholinergic synapse
    432530 (Adcy1)
   04720 Long-term potentiation
    432530 (Adcy1)
   04723 Retrograde endocannabinoid signaling
    432530 (Adcy1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    432530 (Adcy1)
  09149 Aging
   04211 Longevity regulating pathway
    432530 (Adcy1)
   04213 Longevity regulating pathway - multiple species
    432530 (Adcy1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    432530 (Adcy1)
   04714 Thermogenesis
    432530 (Adcy1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    432530 (Adcy1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    432530 (Adcy1)
   05163 Human cytomegalovirus infection
    432530 (Adcy1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    432530 (Adcy1)
   05142 Chagas disease
    432530 (Adcy1)
  09165 Substance dependence
   05032 Morphine addiction
    432530 (Adcy1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    432530 (Adcy1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    432530 (Adcy1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    432530 (Adcy1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     432530 (Adcy1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 432530
NCBI-ProteinID: NP_033752
MGI: 99677
Ensembl: ENSMUSG00000020431
Vega: OTTMUSG00000005134
UniProt: O88444
Position
11 A1; 11 4.72 cM
AA seq 1118 aa
MAGAPRGQGGGGGAGEPGGAERAAGPGGRRGFRACGEEFACPELEALFRGYTLRLEQAAT
LKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCILFLALFVVTNVRSLQVSQLQQ
VGQLALFFSLTFALLCCPFALGGPARSSAGGAMGSTVAEQGVWQLLLVTFVSYALLPVRS
LLAIGFGLVVAASHLLVTAALVPAKRPRLWRTLGANALLFFGVNMYGVFVRILTERSQRK
AFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDN
VSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLT
QPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSN
DVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNTFLRTHNIETFFIVPSHR
RKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRT
ASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKY
HQLQDEYFTSAVVLALILAALFGLIYLLVIPQSVAVLLLLVFSICFLVACTLYLHITRVQ
CFPGCLTIQIRTALCVFIVVLIYSVAQGCVVGCLPWAWSSQSNSSLVVLAAGGRRTVLPA
LPCESAHHALLCCLVGTLPLAIFLRVSSLPKMILLSGLTTSYILVLELSGYTKVGGGALS
GRSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERDDMERVKLDNKRILFNLL
PAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEII
ADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLCTLADFAIDMFDV
LDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVT
EEVHRLLKRCSYQFVCRGKVSVKGKGEMLTYFLEGRTDGNSSHGRTFRLERRMCPYGRGG
GQARRPPLCPAAGPPVRPGLPPAPTSQYLSSTAAGKEA
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggccaaggcggcggcggaggcgcgggcgagcccgggggcgca
gagcgggcggccgggccgggcggccggcgtgggttccgggcgtgtggcgaggagttcgcg
tgccccgagctggaggcgctgttccgcggctacacgttgcggctggagcaggcggccacg
ctgaaagcgctggctgtgctcagcctactggcgggcgccctggcgctggctgagctgctg
ggcgcaccggggccagcgccgggcctcgccaaggggtcgcacccagtgcactgcatcctt
ttcctggcgctgttcgtggtcaccaatgtccgatccctgcaggtgtcccagctgcagcag
gtcggtcagctggcgctgttcttcagcctcaccttcgcgctactctgctgccccttcgcg
ctgggcggccccgcgaggagctctgcaggaggcgcaatgggctcgacggtcgccgagcag
ggggtttggcaactccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgcagc
ctactggccatcggcttcgggctggtggtggctgcctcgcacttactggtcacagccgcc
ttggtccctgccaagcgcccacgtctctggaggacgctcggtgccaatgccctgctcttc
tttggtgtgaacatgtatggcgtcttcgtgcggatcttgacagagcgctcccagaggaag
gccttcctgcaggctcgaaactgcattgaggaccggctgcggctggaggatgagaatgag
aagcaggaacggttgctcatgagcctcttgccccggaatgtcgccatggagatgaaggaa
gacttcctgaagccccctgagaggatttttcacaagatttacatccagaggcatgacaat
gtgagcatcctgtttgcagacatcgtgggtttcacaggtctggcgtcccagtgcacagcc
caggagctggtgaaactgctcaatgaactctttggcaagttcgatgagttagccacggaa
aaccactgtcgccgaatcaagatccttggtgactgctactactgtgtgtctggcctcacc
cagcctaagacggatcacgcccactgctgtgtggagatgggacttgacatgatcgatacc
atcacatccgtggctgaggctactgaagtagacctgaacatgcgtgtgggcctacacacc
ggcagggtcctctgtggtgtcctgggcctacgaaagtggcagtatgatgtatggtccaat
gacgtgaccctggccaatgtcatggaggctgctggcttaccagggaaggtccacatcaca
aagacgaccctcgcgtgcttgaacggggactacgaggtggagccaggtcatggccatgag
aggaacacctttctgagaactcacaacattgagaccttctttattgtgccatcccatcgg
aggaagatattcccaggcttgattctctcggatatcaaaccagccaagaggatgaagttc
aagactgtgtgctatctgctggtgcagctcatgcactgccggaaaatgttcaaggctgag
atccccttctccaacgtgatgacctgcgaggatgacgacaagcggagggcattgagaaca
gcctcggagaagctcagaaaccgttcgtctttctctactaatgtggtctacaccactccg
ggtacacgcgtcaacaggtacatcagccgccttctcgaagcccgccagacagagctggag
atggccgatctgaacttctttactctgaagtacaaacatgtcgaacgagaacaaaaatac
caccagcttcaggacgagtacttcaccagcgccgttgtcctcgccctcatcctggctgcc
ttatttgggcttatctaccttctggtaatcccacagagtgtggctgtcctgctgctgctg
gtattttccatctgcttcttggtggcctgtaccctgtacctgcacatcacgcgggtccag
tgttttccagggtgcctgacgatccagatccgcaccgccttgtgtgtgttcatagtggtc
ttaatctactcggtagctcaaggctgtgtggtgggctgcctgccctgggcctggagctct
cagtctaacagttccctagtggtcctcgcagctggtggccggcgcactgtgctgcctgcc
ctgccctgtgagtctgcacaccatgccctgctctgctgcctggtgggcaccctcccacta
gccatattcctgcgggtgtcctccttgccaaagatgatcctgctgtctgggctgactact
tcctacatccttgtcctggagctcagtggatacaccaaggttgggggcggtgccctctct
gggcgcagctatgagccaatcatggctatcctgctgttctcatgcacgctggccctgcac
gccaggcaagtggatgtcagactacggctggactacctctgggcagcacaggcggaggag
gaacgggatgacatggagagagtcaagctggacaacaagaggatcctcttcaatctcctg
ccagctcacgtcgcacagcacttcctcatgtccaatccccggaacatggacctctactac
cagtcctactcccaggtgggcgtcatgtttgcctccatccccaacttcaatgacttctac
atagaactggatggcaacaacatgggtgttgagtgtctgcggctcctcaacgagatcatt
gccgactttgatgagctcatggacaaggacttctataaggacctggagaagattaagacc
attgggagcacttacatggctgccgtggggctggcgcccacagcaggaaccagggctaag
aagtccatctcctcccacctatgcacactggcagacttcgccatcgacatgtttgatgtt
ctggatgaaatcaactaccagtcctacaacgactttgttctccgagttggcatcaacgtt
ggccccgtggttgctggagtgatcggtgctcgcaggccccagtacgacatctggggaaac
acagtcaatgtggccagtcggatggatagcactggggtccagggacgaattcaggtgact
gaggaagtccaccggctgctgaagaggtgctcataccagtttgtgtgcagaggcaaagtc
agcgtgaagggcaagggagagatgctaacgtactttctagaaggcaggactgatggaaac
agttcccacggcaggacctttcgcttggaacgaaggatgtgtccttatgggagaggcgga
ggccaggccagacggcccccactgtgtcccgcggctggacccccagtcagaccagggctc
cctccagcccccactagccagtacctgtcatccacagcagcagggaaggaagcctag

DBGET integrated database retrieval system