KEGG   Mus musculus (mouse): 432572
Entry
432572            CDS       T01002                                 

Gene name
Specc1, 2810012G08Rik, B230396K10Rik, Cytsb
Definition
(RefSeq) sperm antigen with calponin homology and coiled-coil domains 1
  KO
K23028  cytospin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    432572 (Specc1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     432572 (Specc1)
SSDB
Motif
Pfam: CH CAMSAP_CH HAP1_N DUF4200 Fez1
Other DBs
NCBI-GeneID: 432572
NCBI-ProteinID: NP_001025107
MGI: 2442356
Ensembl: ENSMUSG00000042331
Vega: OTTMUSG00000005853
UniProt: A0A0J9YUR2
Position
11; 11 B2
AA seq 978 aa
MGNHSAKLEEPETGTIPTTKRTGIPAPRELSVTISRERSVPRGPSSSKKLGSSPTSSCNP
TPTKHLRTTPAKPKQEHEGAEKAVLESQVRELLAEAKTKDSEINRLRSELKKCKERWALS
TEDANASDPSAEGTASPESDAQPLIRTLEEKNKTFQKELADLEEENRALKEKLTYLEQSP
NSEGAASHTGDSSCPTSITHESSFGSPVGNELSSETDEYRRTTHGSALRTSGSSSSDVTK
ASLSPDASDFEHITADTPSRPLSATSNPFKSSKGSPTGSSPNNASELSLASLTEKIQKME
ENQHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKTILETSFHQHRERAEQLSQENE
KLINLLQERVKNEEPSAQGGKVLELEQKCTDILEKSRFEREKLLNIQQQLTCSLRKVEEE
NQGAIDMIKHLKEENEKLNGFLEHERCNNSVMAKTLEECRVTLEGLKMENGSLKALLEAD
KQKAIEASSTVGQTAENFEVQEMLKVARAEKDQLQLSCTELRQELLKANGEIKHVSSLLA
KMEKDYSYLKEVCDHQAEQLSRTSLKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKL
HNNQLISELEGSVIKLEEQKSDLERQLKTLTKQIKEETEEWRRFQADLQTAVVVANDIKC
EAQQELRTVKRRLLEEEEKNARLQKELGDIQGHSRPVNEEPEPSEADAAGRWRGVYVNRT
SPAPSDSATTVKSLIKSFDLGHSGGTGQSISVHKTPRSPLSGIPVRTAPAAAVSPMQRHS
TYSSMKPASKGTSQRLDLPDLPLSDLLKGRAEDRKSDPYLRKSPSLESLSRPPSLGFGNT
RLLSASTGGLKPSKLSVERRDPLAALAREYGGSKRNALLKWCQKKTEGYANIDITNFSSS
WSDGLALCALLHTYLPAHIPYQELNSQEKKRNLLLAFEAAQSVGINPSLELSEMLYTDRP
DWQSVMQYVAQIYKYFET
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgggcaaccactcagcgaagctggaggagcccgagacagggactattccaacaactaaa
cggacaggcattccagctccacgggagctctcagtaactatctccagagagaggtctgtg
ccacgtggtccctccagctcaaagaagttaggctccagcccaacttcttcctgcaatccc
actcctaccaagcatctgaggaccacccctgcaaaacctaagcaagagcatgaaggtgca
gagaaggctgtgctcgagtcccaggtacgagaacttctggcagaagccaaaaccaaagac
agtgaaatcaacaggcttcgaagtgaactaaaaaaatgcaaagagaggtgggccctgagc
actgaggatgccaatgcttcagacccaagtgcagagggaacagcatccccagaaagtgat
gcacagcctttgataagaaccctggaggagaagaacaagacctttcagaaagagcttgct
gacctagaggaagaaaacagggccttgaaggagaaactgacttaccttgagcagtcacca
aattcagaaggggcagcaagtcacactggtgacagcagctgcccaacatctataacccac
gagtccagttttggaagcccagttggaaatgagttgtctagtgaaacagatgagtacaga
agaaccacacatgggagtgccttgcggacatcagggtcttcaagcagtgatgtcaccaaa
gcctctctgtcaccggacgcctcagattttgagcatatcactgcagacaccccgtctcgg
cccctgtcagccactagcaacccttttaagagctccaagggctcccctactgggagctcc
ccaaacaatgcaagtgagctgtccttggcatctctcacggagaagatacagaagatggag
gagaatcagcacagcactgcagaagagctgcaggctactctgcaggaattatcagaccag
cagcagatggtgcaggaactgacagccgagaacgagaagctagtggatgagaagaccatt
ctggagacctccttccaccagcaccgagagagggcagaacagctgagtcaggaaaatgag
aagctgatcaaccttttacaggagcgagtgaagaatgaggaacccagtgcccagggaggg
aaggtccttgagctggagcagaagtgcacggatattctcgagaagagccgctttgaaaga
gagaagctgctcaacattcagcagcagctgacctgtagcctacggaaggttgaggaagaa
aaccaaggcgctatagacatgattaagcacctgaaggaagaaaatgagaagctgaatggg
ttcctagaacatgagcggtgtaataatagtgtgatggccaaaactctggaggaatgtcga
gttaccttggaaggcttgaaaatggagaatgggtccttgaaggctcttttggaggctgat
aagcaaaaagccatagaggccagcagtactgtggggcagacagcagagaacttcgaggtt
caggagatgctgaaagtggctcgagctgagaaagatcagttgcagctgtcttgcacagag
ctcagacaagaattgctaaaggcaaatggtgaaattaaacatgtttccagcctgctagct
aagatggagaaagattattcgtacctgaaagaagtctgtgatcatcaagcagaacagctg
agcagaaccagcctaaaattacaagagaaagcttcagaaagtgacgcagaaatcaaagac
atgaaagagaccatatttgaattggaagaccaggtggagcagcatcgcgccgtcaagtta
cacaataaccagctcatcagtgagctggaaggcagtgtgatcaagctggaggagcagaag
tcagacctagagcggcagttaaagacgctaacaaaacagataaaggaggaaacagaagaa
tggaggcgattccaggcagacttacagactgcagtggtagtggccaacgacatcaagtgt
gaggctcagcaggagctgcgcactgtgaagaggaggttgctggaggaggaagagaaaaat
gccaggctgcagaaggagctgggagacatacaggggcacagcagacctgtgaatgaagag
ccagagccctcagaggccgatgctgctggccggtggcgtggagtctatgtcaacagaaca
tctccagctccttcagactctgcaaccacagtaaagtcactgatcaaatcatttgactta
ggacactcaggtggaactggccagagtatttctgtccacaagactcccagaagccccctg
agtggaatcccagtgaggactgctcctgccgctgctgtctctccgatgcagagacattca
acatacagcagcatgaagccagccagcaaagggacgtctcagcgcttggatctgccggac
cttcccctctctgatctgctgaagggaagggccgaggaccggaagtcagacccttacctc
cgaaagagtccctcactggagtccctgagcagacccccctccctgggctttgggaacacc
agactgctgagtgcgtccaccgggggtctgaagccaagcaagctcagtgttgaaagaaga
gaccctctggcagccctggcccgggagtatggtggctctaagcgtaacgcactcctgaaa
tggtgtcagaagaagacagaaggttatgcgaacattgatatcaccaatttcagcagcagc
tggagtgatgggctggccctctgtgctctgctgcacacctacctgcctgcccacatccca
taccaggaattgaacagtcaggagaaaaaaaggaatctcctgttggcatttgaagccgcg
cagagtgtaggcatcaaccccagcctggagctcagtgagatgctgtacacggaccggcct
gactggcagagcgtgatgcagtatgtggcccagatctacaagtactttgagacataa

DBGET integrated database retrieval system