KEGG   Mus musculus (mouse): 432677
Entry
432677            CDS       T01002                                 

Gene name
Vrtn, 7420416P09Rik
Definition
(RefSeq) vertebrae development associated
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: HTH_Tnp_1 HTH_23 HTH_Tnp_1_2 DUF1492 HTH_24
Other DBs
NCBI-GeneID: 432677
NCBI-ProteinID: NP_001028948
MGI: 3588197
Ensembl: ENSMUSG00000071235
UniProt: Q3SYK4
Position
12; 12 D1
AA seq 740 aa
MTSRDQLVQQVLRDLQEAVESEGLEGLIGAALEAKQVLSSFTLPICQKGGPGAQVLEVDS
VALSLYPEDAPRNMLPLVCKGEGSLLFEATSLLLWGHTGLSLELRARTVVEMLLHRHYYL
QGMIDSKVMLQAVRYSLCSEESPEMTNLSFATLEAIFDADVKATCFPTSFSNVWHLYALA
SILECNIYSIYPMRNIKIRPYFNRVIMPRCSTHVTSMLHIMWAGQPLTSHLFRHQYFAPV
VGLEEVEADCTASLNPVPPNLGPLLPPAKTLELLNREPGLSYSHLCDRISITKSTFYRWR
RQTQEHRQKVATRFSAKHFLQDSFHRGGFVPLQQFLQRFPEISRSTYYAWKHELLGSGAN
SALGPATPSREALAVPEVERPPGKKAAEEVGCSSLAAAMLSPPSMILMQRAKSFLEYCIS
LNKLVPYRCFKCRFPGISRSTYYNWRRKALRRTPSFKLSQAAFETAESLQPTDVGKETPF
SLKREAGEEETGKAGSGAPLTSRGLISPKMPLSRWQRRLRRAARKQVLNGHLPFCRFRLR
YPSLLPSTFWVWKSLSRRSPGMQIPSLSQRRQKPQGRQKPEGRQKPEEQQKPEGRQKPEG
RQKPVEPQAMEADQNVPAMVVPPAETLPVATSPEDVPGGPSREGNIIQEAAMTQSQPHSG
SLPSQTLAEAPGGSDGQVLVMDMLTTTRFKAQAKLFLQKRFQSKTFPSYKEFQALFPLTA
RSTYYMWKRALYEGLTLIDG
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgacgtctcgggatcagctggtgcagcaggtgctgcgcgacctgcaggaggcagtggag
tccgagggcttagagggtctcatcggtgctgccctggaggccaagcaggtcctatcttcc
ttcacccttcccatctgccagaagggcggccctggcgctcaggtgctggaggtggactca
gtggccttgagtctgtacccggaggatgctcctcggaacatgctgcccttggtgtgcaag
ggtgaggggagcctgttgtttgaagcgaccagcctgttgttgtgggggcacacgggtctc
agcctggagctgcgagcccgcactgtggtggagatgctgctgcacaggcactattatctg
cagggcatgatcgactccaaggtgatgctgcaggctgtgcgctactccttgtgctctgag
gagtcccctgagatgaccaacttatcttttgccacactggaggccatctttgatgctgat
gtaaaggctacgtgcttcccaacgagcttctccaatgtgtggcacttgtatgccctcgcc
tccatccttgaatgcaacatctactccatctaccccatgcgcaacatcaagatccgaccc
tattttaaccgtgttatcatgcctcgctgctccacccacgtgacctccatgctgcacatc
atgtgggctggtcagcccctcactagccacctcttccgtcaccagtattttgcccctgtt
gttgggctggaggaggtggaggctgactgtactgctagcctgaaccccgttcctccaaac
ctgggtcctctgctaccacccgctaaaaccctggagctgctcaaccgtgaacctggcctc
agctactcccacctctgtgaccgcatcagcatcaccaagagcaccttctaccgctggcgg
cggcagacccaagagcaccgtcaaaaggtagccacccgcttctctgccaagcacttcctg
caggacagtttccaccgtgggggctttgtgccattgcagcagttcctgcagagattccct
gagatctcccgttctacctactatgcttggaagcatgagttgctgggctctggtgccaac
tcggccctgggcccggccactccatccagggaggcactggctgtgccggaggtggagagg
ccaccggggaaaaaggctgctgaggaggtggggtgctcctcactggcagcagcgatgttg
agccctcctagtatgatcttaatgcagcgtgccaagtctttcttggagtattgcatctct
ctgaacaaactggtaccatatcgctgcttcaaatgcaggttccctggcatctcgaggtct
acctactacaactggaggcggaaagccctcagaaggacccccagtttcaagttgtcccaa
gcagcttttgaaactgctgagtctctccagccaacagatgttgggaaagagacccccttc
tctttgaagagagaagcgggagaggaggagacaggaaaagcaggaagtggggctcctctg
acttcccgggggctcatatccccaaagatgcccttatctcgttggcagagacgactacgc
agggctgcccgcaagcaggtgctaaatgggcacctacccttctgtcgcttccgcctccgc
tatcctagtctgttaccttccactttttgggtatggaaaagtctttcccggagatcgccc
gggatgcagattccctctttgagccagaggaggcagaagcctcagggacggcagaagccc
gagggacggcagaagcccgaggaacagcagaagcccgagggacggcagaagcccgaggga
cggcagaagccagttgaaccacaggctatggaagctgatcagaatgtaccggctatggtg
gttcctccagcggagacactgccagtggctacttctccagaagatgtcccaggagggcct
tccagagagggaaacatcattcaagaggcagctatgacccagagccaaccccatagtgga
tcgttgccaagccagactctggcggaggcacccgggggcagtgatgggcaggtgctggtg
atggacatgcttaccaccacgaggttcaaggcccaggccaagctgttcctgcagaagcgg
ttccagtctaagactttcccctcctacaaggagttccaggcgctcttccccctcactgcc
cgctccacctactacatgtggaagcgggcgctctatgaaggtctcacactgattgatggc
tga

DBGET integrated database retrieval system