KEGG   Mus musculus (mouse): 432720
Entry
432720            CDS       T01002                                 

Gene name
Akr1c19, 1810010N06Rik
Definition
(RefSeq) aldo-keto reductase family 1, member C19
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 432720
NCBI-ProteinID: NP_001013807
MGI: 2653678
Ensembl: ENSMUSG00000071551
Vega: OTTMUSG00000027684
UniProt: G3X9Y6
Position
13; 13 A1
AA seq 323 aa
MSSKQQCVKLNDGNFIPALGFGTYKPEEVNENKPLEAIHLALEAGFRHIDTAYVYQTENH
VGQAIRSKIAAGLVKREDIFLTTKLWCTFHRPELVRSNLEKSLKNLQLDYADLYLIHYPV
QMKPGEDLFPEDEHGKTLFDTVDICATWEAMEKCKDAGLVKSIGVSNFNSRQLEKILNKP
GLKYKPVCNQVECHLYLNQRKLLNYCKSKDIVLVAYCALGSQRPKRWVDPSSPVLLNDPI
LCDMAKKHKRSPAQIALRYHLQRGIVVLAQSYKENEIKENIQVFEFELPSEDMKILDSLD
RNLRYAPAPFGEGHPEYPFSDEF
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagttccaaacagcaatgtgtgaaactgaatgatggcaacttcatccctgcgctgggc
tttggcacctacaaaccagaagaggttaatgaaaataagccactggaggctatccattta
gctctagaggctgggttccgccatattgatactgcttatgtgtaccaaactgaaaatcat
gtagggcaggctattcgaagcaagattgcagctggccttgtgaaaagagaagacatattc
ctcactacaaagctttggtgcactttccataggccagagctggttcgctctaacttggag
aaatctttgaaaaacctgcagctggattatgctgacctctatcttatacattatcccgtg
caaatgaagccaggggaagatctgtttccagaagatgagcatggaaaaacattatttgac
acagtggatatatgtgccacatgggaggccatggagaagtgtaaggatgcaggattggtc
aagtccattggtgtgtccaactttaatagcaggcagctggagaaaattctgaataagcct
gggctcaaatacaagcctgtttgcaaccaggtggaatgccatctctacttgaaccagagg
aagctgttgaactactgcaagtcaaaggacattgttctagttgcctactgtgctcttgga
tctcaacgacctaagcgatgggtagacccaagctctccagttctcttgaatgatccaatt
ctttgtgacatggcaaaaaagcacaagcgaagtccagctcagattgcccttcgctatcat
ctccaacgtggaattgtggttcttgcccagagttacaaagagaatgagataaaagagaac
atacaggtatttgaatttgagctgccttcagaggatatgaaaatcctagatagcctggac
agaaatttaagatatgcacctgctccatttggagagggtcacccagaatatcccttttct
gatgaattttag

DBGET integrated database retrieval system