KEGG   Mus musculus (house mouse): 432769
Entry
432769            CDS       T01002                                 
Symbol
Zfp708, Rslcan11
Name
(RefSeq) zinc finger protein 708
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    432769 (Zfp708)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    432769 (Zfp708)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    432769 (Zfp708)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_11 Zn-ribbon_8 zf-C2H2_6 C1_1 XPA_N zf-C2H2_jaz zf_UBZ zinc_ribbon_15 zf-met zf-H2C2_5 zf-C2HC_2 C1_4
Other DBs
NCBI-GeneID: 432769
NCBI-ProteinID: NP_001012325
MGI: 3040674
Ensembl: ENSMUSG00000058883
UniProt: F8VPP0
Position
13:complement(67217462..67246040)
AA seq 541 aa
MIIEVFINAKEMTKDPLSFTDVAIDFSADECECLDSAQWNLYKEVMLENYSNLVFLGLAF
SKPYLVTFLEQSSDLWSVKRKASVAIHLGSKAHKCKECGKSFDRNSVLIQHQRIHTGERP
YKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCD
DCGKAFSCSSYLYKHQRIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGK
AFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNY
SSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYL
HKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQ
RIHTREQPYKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHT
GERPYKCEVCGKAFTSSSNLKYHWRLHTGEKPYKCEQCGKAFKNSSNVTRHYKIHTRENP
D
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgataattgaagtcttcatcaacgccaaagaaatgaccaaggaccctctgtcatttaca
gatgtggccattgatttctctgcagatgagtgtgaatgtctggactctgctcagtggaat
ttgtataaggaagtgatgttggagaattacagcaaccttgtgttcctgggtcttgctttc
tctaagccatacctggtcacatttctggagcagagttcagatctgtggagtgtgaagagg
aaggcatcagtggccatccatctaggatcaaaagcccataaatgtaaagaatgtgggaaa
tcctttgataggaactcagtccttattcaacatcaaagaattcatactggagagaggccc
tacaaatgtgaagaatgtggcatggccttcaccggtcgctgcattctttctaagcaccag
cgaatccatactggagaaaaaccctacaaatgtaaagaatgtggcaaagctttcagctgt
tcttctaaccttcaccaacaccaacaaattcatagggaagagaaaccctataaatgcgat
gactgtgggaaggcctttagctgttcttcatatctgtataagcatcagcgaatccatact
ggcatgaaaccctacaaatgcaaggaatgtggcaaggcctttaactgttctgcaaacctt
atttaccaccagagaattcatactggagagaaaccatataagtgtggtgaatgtgggaaa
gcctttaccatttattcaacatttatgaatcaccagcgaacacatagtggagaaaaaccg
tatgaatgcaaagactgtgggaaagcctttactaattgttataatctaattcaacaccaa
agaattcatactggagagaaaccctatgcatgtgaagaatgtggcaaatcttttaactat
tcttcccatcttaaacaacacaaaagaatccatactggagagaaaccatataaatgtgaa
gtgtgtggcaaagcttttaactgttccgattatcttgttaagcatcaaagaattcatact
ggagagaaaccctacaaatgtgaagtatgtggcaaagcttttagcttttctacatatctg
cataaacatcaaagaatccacactggagagaaacgctacagatgtgaagaatgtggtaaa
gcttttactaattattcagggcttattgttcaccgaagagtacatactggagagaaaccc
tacaaatgtgaagaatgtggcaaggcctttagtgttcacacatcactctctaaacatcag
agaattcatacgagagagcaaccttacaaatgtgatgaatgtggaaagacctttagtgtt
cactcaacattctctaaacatcagataatgcatactagagagaaaccctacaaatgcaaa
cactgcgacaagaccttcaaatatccttcaccccttgttcaacatgaaagaattcacact
ggagagagaccctacaaatgtgaagtttgtggcaaggcctttacttcttcttcaaatctt
aaatatcattggagacttcatactggcgagaagccctataaatgtgaacaatgtggtaaa
gcctttaaaaatagttcaaatgtcactcgacactacaaaattcatactagagaaaatcca
gattaa

DBGET integrated database retrieval system