KEGG   Mus musculus (mouse): 432964
Entry
432964            CDS       T01002                                 

Symbol
Iqank1, 4933407E14Rik, K230010J24Rik
Name
(RefSeq) IQ motif and ankyrin repeat containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank IQ AAA_9 DUF4458
Other DBs
NCBI-GeneID: 432964
NCBI-ProteinID: NP_001357849
MGI: 3588184
Ensembl: ENSMUSG00000102018
Vega: OTTMUSG00000045037
Position
15; 15 D3
AA seq 572 aa
MSTKKGGPKAASGKGQALLPGSKLRATAGKPRESRQLQRKASHPSKGSFSENPQAPAAPT
AEDKAAIVIQCAFRQYLARRELARRCQERQEYLDEMEKLQKEAYLALVRQEQEAARRQRE
KEEAEERARREELQRRRRLLEAAFEGDLGEIRQVLKEVEQLMTREGVGYDEDGKARRLQR
RVATVECEDSHGNTPLSEAAAGGQTMAIQLLAELGANPNTKGAFGRTPLYRAAFGGHLEA
VEELLKIGADPRMYADDGSTPEQVASLAAVASVLQSWDLSLTEAMLKNMEAEQQRRAQEA
QKHKENEAKRINIKVQQLAKEQQKCQKELQQAYCELNRRIMEHDKCERKFMGNTELTLQA
IKDAEAQVDRLQQEAQKAEETLAMARLELREQTPEDEDTEPGLKCRVTELHDVLMKDVGD
RIRADGRWPLVIDPSGQAATFLRYQDTNYVDTLNPEHLRPERIRLALLGALRYGKPLVFD
LRQVNLFPVVQQQLEVVQTGLAQALLNRGLLAKEGYLSLLRPTDGPEYDPSQFQEARLEN
FRLFFVTQVKWPPADQLQTLLPVRVQMPSGRF
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgagcactaagaagggggggcccaaagctgcatcagggaaggggcaggcgctcctccct
gggtccaagcttcgagctactgctgggaagccgagagagagtcgccagctgcaaaggaag
gcaagtcatccaagcaaagggtccttctctgagaacccccaggcccctgcagcgccaacc
gcagaggacaaagctgccatcgtcatccagtgtgccttccggcaatatctggcgcgaagg
gagctggctcgtcgttgtcaggagcgtcaggagtacctggacgagatggagaagctgcag
aaagaggcctacctggccttggtgcgccaggagcaggaggcggcgcggcggcagcgggag
aaggaggaggcagaggagcgcgcccggagggaggagctgcagcgccgccgtcgcctgcta
gaggccgccttcgaaggggacctgggggagatccgccaggtgctcaaggaggtggagcag
ctgatgaccagagaaggcgtgggctacgacgaggacggcaaggctcggcgactgcagagg
cgcgtggccaccgtggagtgcgaggacagccacgggaacacgcctctctccgaggcggcg
gcgggcgggcagaccatggccatccagctgctggcagagctgggtgccaaccccaacacc
aagggcgccttcggccgcacgccactctaccgggcagcttttgggggccacctagaagcc
gtggaggagcttctgaagatcggagcagacccccggatgtacgcggatgacgggagcacc
ccggagcaggtggcctccctggccgcggtggccagcgtgctgcagtcatgggacctgagc
ctcacagaagctatgctcaagaacatggaggcagagcagcagcgccgtgctcaggaggcc
cagaagcacaaggagaacgaggccaagcgcatcaacatcaaggtgcagcagctggctaag
gagcagcagaagtgtcaaaaggagctccagcaggcctactgtgagctcaatcggaggatc
atggaacatgacaagtgtgagaggaagttcatgggcaataccgaactcacactacaggcc
atcaaggatgcagaggcccaagtggacagattgcagcaagaggcacagaaggctgaggag
acactggccatggccaggctggagctgcgggaacagactccggaggacgaggatacagaa
cctgggctcaagtgccgggtcacggagctccatgacgtgctgatgaaggacgtaggggat
cgcatccgagccgatggacggtggcctcttgtcatcgacccttctggccaggcagccact
ttcttgagataccaggacaccaactatgtggacaccctaaatccggagcacttgagacct
gagaggattcggctggctctcctgggggcactcaggtacgggaagccactggtgtttgac
ctgcgtcaagtgaacctgttcccagtagtacagcaacagctggaggtcgtgcagactggc
ctggcacaggccctgttgaatcgtgggctgctggcaaaggaagggtatctgtcactgctt
cggccaacagatggacctgagtatgacccctcccagttccaagaggctcgcctagagaac
ttccgcctcttctttgtcacccaagttaagtggcccccagctgaccagctgcagaccctg
ctcccagtgcgtgtgcagatgcccagtggaaggttctag

DBGET integrated database retrieval system