KEGG   Mus musculus (mouse): 433256
Entry
433256            CDS       T01002                                 

Gene name
Acsl5, 1700030F05Rik, ACS2, ACS5, Fac, Facl5
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 5
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    433256 (Acsl5)
   00071 Fatty acid degradation
    433256 (Acsl5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    433256 (Acsl5)
  09143 Cell growth and death
   04216 Ferroptosis
    433256 (Acsl5)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    433256 (Acsl5)
   03320 PPAR signaling pathway
    433256 (Acsl5)
  09159 Environmental adaptation
   04714 Thermogenesis
    433256 (Acsl5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    433256 (Acsl5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    433256 (Acsl5)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     433256 (Acsl5)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   433256 (Acsl5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   433256 (Acsl5)
  Exosomal proteins of breast cancer cells
   433256 (Acsl5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 433256
NCBI-ProteinID: NP_082252
MGI: 1919129
Ensembl: ENSMUSG00000024981
UniProt: Q8JZR0 Q3UC67
Position
19; 19 D2
AA seq 683 aa
MLFIFNFLFSPLPTPALICLLTFGTAIFLWLINRPQPVLPLIDLDNQSVGIEGGARRGAF
QKNNDLILYYFSDAKTLYENFQRGLAVSDNGPCLGYRKPNQPYKWISYKQVSDRAEYLGS
CLLHKGYKSSQDQFVGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADI
PVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCGVEMLSLHDAENIG
KENFKKPVPPKPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIFQPTSDDV
TISYLPLAHMFERLVQGILFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYD
KVQNEAKTPLKKFLLNLAIISKFNEVKNGIIRRDSLWDKLVFSKIQGSLGGKVRLMITGA
APISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVA
DMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDR
KKNIFKLAQGEYIAPEKIENVYSRSRPVLQVFVHGESLRSFLIGVVVPDPDSLPSFAAKI
GVKGSFEELCKNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLK
AKRVELAKFFQTQIKSLYESIEE
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgctttttatttttaacttcttgttttccccacttccaactccggccctgatctgcctc
ctgacgtttggaacggccatcttcctgtggctgatcaacagacctcagccagttttacct
ctcattgacttggacaaccagtctgtggggattgagggaggagcacggaggggcgctttc
cagaagaacaatgacctaatcctttattacttctcagacgccaagacgttgtatgaaaat
ttccaaagaggacttgctgtgtctgacaatgggccttgcttgggatacagaaagccaaac
cagccctacaaatggatctcctacaaacaggtgtctgatcgagcagagtacctgggctcc
tgtcttttgcataaaggatataagtcatcacaggaccaatttgttggcatctttgctcaa
aataggccagagtgggtcatctctgagttagcctgttacacatattccatggtagctgtc
cccctgtatgacacgctgggtacagaagccatcatctttgtcatcaacagggctgatatc
cctgtggtcatctgtgatacaccccaaaaggcaacaatgctagtagaaaatgtggaaaag
ggcctcacaccaggcctgaagacgatcatcctcatggacccttttgatgacgacctgatg
aaaagaggagaaaagtgtggagttgagatgttatccctgcatgatgcggagaatataggc
aaagagaacttcaaaaaaccagtgcctccgaagccagaggatctgagcgtcatctgtttc
accagtggaactacaggtgaccccaaaggagctatgctaacccatgaaaatgttgtttca
aacatggctgctttcctcaaatttctggagcctatcttccagcccacctctgatgatgtg
accatatcctaccttcccttggctcatatgtttgagaggcttgtccagggtatcttattt
tcctgtggaggcaaaattgggttcttccaaggagatatccggttgctacctgatgacatg
aaggctttgaaacccacagtgtttcctacagtgcctcgactccttaacagggtctatgat
aaggtacaaaatgaagccaagacacctttgaagaagttcttgttgaacttggctatcatc
agtaaattcaatgaagtgaaaaatggcatcattcggcgggacagtttgtgggacaagctc
gtgttttcaaagattcaaggaagcctgggggggaaggttcgcctcatgatcactggagcc
gcccccatctccactccagtcttgacattcttcagggctgcaatgggatgttgggtgttt
gaagcttatggccaaacagaatgcacaggtggatgttcaattacatcacctggggactgg
acagcaggtcatgttgggactccagtggcttgcaattttgtaaagctggaagatgtggct
gacatgaactacttttcagtaaacaacgaaggcgagatctgcatcaaaggtaacaatgtg
ttcaaaggctacctaaaggacccagagaaaacacaggaagtactggacaaggatggatgg
cttcacactggggacattggtcgctggcttccaaatggaactctgaaaattgttgaccgg
aagaagaatattttcaagttggcacaaggagaatacattgccccagagaagattgaaaat
gtttattccaggagcagaccagtattgcaagtttttgtccatggggagagcttacggtca
ttcctgatcggagtggtggttcccgacccagattcacttccctcatttgcagccaagatc
ggggtaaagggatcatttgaagaactgtgcaaaaaccaatgtgtaaaggaagccatttta
gaagacttgcagaaaattgggaaagagggtggcctgaaatcctttgagcaggtcaaaagt
atctttgtgcatccagagcccttcactattgaaaacggacttctgacaccgacactgaaa
gccaaacgagtagagcttgccaagttcttccagacacaaatcaagagcctctatgagagc
atcgaggagtag

DBGET integrated database retrieval system