KEGG   Mus musculus (mouse): 433485Help
Entry
433485            CDS       T01002                                 

Gene name
Syndig1, AW123113, DSPC2, Gm14134, H2C20orf39, Tmem90b
Definition
(RefSeq) synapse differentiation inducing 1
  KO
K23903  synapse differentiation-inducing gene protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    433485 (Syndig1)
Transporters [BR:mmu02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   433485 (Syndig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD225
Motif
Other DBs
NCBI-GeneID: 433485
NCBI-ProteinID: NP_001078990
MGI: 3702158
Ensembl: ENSMUSG00000074736
Vega: OTTMUSG00000015750
UniProt: A2ANU3
Position
2 G3; 2
AA seq 258 aa AA seqDB search
MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPG
SLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRS
PTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRD
HLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDFHQASTSSRRALFLAVLSITIGTGI
YVGVAVALIAYLSKNNHL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggatggcatcattgagcagaagagtgttctggtacacagtaagatcagtgatgctggc
aaaaggaatggcttaattaacaccagaaacttcatggctgagagcagggatggtctggtg
tctgtttacccagcacctcagtaccagagccacaggctagtggccagtgcggcaccaggc
agcctggaaggaggcagaagtgagcctgtgcagcagttgctggacccaaacactctgcag
cagtccgtcgagtcccactatcgtcccaatatcatcctctactcagatggtgtacttcga
tcctggggggatggtgtagccactgactgctgtgagaccaccttcattgaggaccggtca
cccaccaaagacagcctggagtaccccgatgggaaattcatcgacctctcaggggatgac
atcaaaatccataccctgtcctatgacgtggaggaagaagaggagttacaggagctggag
agtgactactccagcgacacagaaagtgaggacaacttcctcatgatgcccccacgggat
cacctgggactcagcgtcttctccatgctctgctgcttctggcctttgggcattgcagcc
ttctacttgtcccatgagacaaacaaagctgtggccaaaggagacttccatcaggccagc
accagctctcggagggccctgttcctggcagtcctgtccattactattggaactggcatc
tatgtgggtgtggctgttgccctcattgcctacctctccaaaaacaaccacctgtga

DBGET integrated database retrieval system