KEGG   Mus musculus (mouse): 433667Help
Entry
433667            CDS       T01002                                 

Gene name
Ankrd13c, AI505652, AU022220
Definition
(RefSeq) ankyrin repeat domain 13c
  KO
K21437  ankyrin repeat domain-containing protein 13
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    433667 (Ankrd13c)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    433667 (Ankrd13c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GPCR_chapero_1 Ank_2 Ank_4 Ank Ank_3 Ank_5
Motif
Other DBs
NCBI-GeneID: 433667
NCBI-ProteinID: NP_001013828
MGI: 2139746
Ensembl: ENSMUSG00000039988
Vega: OTTMUSG00000052510
UniProt: Q3UX43
Position
3; 3 H4
AA seq 541 aa AA seqDB search
MTGEKIRSLRRDHKPSKEDGDVLEPCEEEATAALGGAFTGGRSGPGGSGKGGKACHKIFS
HHHRLQLKAPAVPGPGVPAPPQHNAVTATCPAPACLGGSNPALVADGGGCPSLYPVHECV
FKGDVRRLSSLIRTHNIGQKDNHGNTPLHLAVMLGNKECAHLLLAHNAPVKVKNAQGWSP
LAEAISYGDRQMITALLRKLKQQSRESVGEKRPRLLKALKELGDFYLELHWDFQSWVPLL
SRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFIFNGDAAPSESFVVLDNEQKV
YQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDKTERVGNFLAD
FYLVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGSLAEQSFEPVRRQSLTPPPQNTI
TWEEYISAENGKAPHLGRELVCKESKKTFKATVAMSQEFPLGIESLLNVLEVIAPFKHFN
KLREFVQMKLPPGFPVKLDIPVFPTITATVTFQEFRCDEFDGSIFAIPEDYKEDPSRFPD
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggagaagatccgctccctgcggagggaccacaagcccagcaaagaggacggg
gacgtgctggagccctgcgaggaggaggcgacagccgcgctcggcggcgccttcaccggg
ggcagaagcggaccgggcggcagcggcaagggcggcaaggcctgccataagatcttcagc
caccaccaccggctgcagctgaaggcgcccgccgttccgggccccggcgttccggccccg
ccgcagcacaacgcagtgactgccacctgccctgccccggcctgcctgggcggcagcaac
cccgctttagtcgctgacggaggcggctgcccctcgctctacccggtccacgagtgcgtc
tttaagggggacgtgaggagactgtcctcgctcatccgcacgcacaatatcggacagaaa
gataatcatggaaacactcctttacatcttgctgtgatgttaggaaataaagaatgcgca
catttactgttggctcataatgctccagtaaaggtgaaaaatgctcagggatggagccct
cttgcggaagccatcagctatggagacagacagatgatcacagctcttctaaggaaactc
aagcagcaatctagggagagtgttggagaaaaacgacctaggttgttaaaagccctaaaa
gagttaggtgacttttacctagaacttcactgggattttcaaagctgggtgcctttgctt
tcccgaattctgccttctgatgcctgtaaaatatacaagcaaggtatcaacatcaggctt
gacacaactctcatagactttactgacatgaagtgccaacgaggggatctaagcttcatc
ttcaatggggatgctgcaccctctgagtcttttgtagtgttagacaatgaacaaaaagtt
tatcagcgaatacaccatgaggagtcagagatggaaacagaagaagaagttgatatttta
atgagcagtgatatttattctgcaactttatcaaccaaatccatttctttcacacgtgcc
caaactggatggctttttcgggaagataaaacagaaagagtaggaaactttttggcagac
ttttatctggtgaatggacttgttctagaatcaaggaaaaggagggagcacctgagtgag
gaggacatcctgcggaacaaggccatcatggagagcctgagcaaaggggggagcctggcg
gagcagagctttgagccggttagaagacagtcccttacccctcctcctcagaacactatt
acgtgggaagaatacatatccgctgaaaatggaaaggcaccacacctgggcagagaactg
gtgtgcaaagagagcaagaaaacatttaaagccactgtagccatgagccaggaatttccc
ctgggaattgagtcattgttgaatgttctagaagtaatagcacccttcaagcactttaac
aagcttagagaattcgttcaaatgaagcttcctccaggctttcctgtaaaattagatata
cccgtgtttcccacaatcacagccactgtgacttttcaggagttccgatgtgatgaattt
gatggatccatctttgctatccctgaagactacaaggaagacccaagtcgttttcctgac
ctttaa

DBGET integrated database retrieval system