KEGG   Mus musculus (mouse): 433752Help
Entry
433752            CDS       T01002                                 

Gene name
Frg2f1, AA415398
Definition
(RefSeq) FSHD region gene 2 family member 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FRG2 CDC45 Suf
Motif
Other DBs
NCBI-GeneID: 433752
NCBI-ProteinID: NP_001004178
MGI: 3035485
Ensembl: ENSMUSG00000087385
Vega: OTTMUSG00000009434
UniProt: Q6P3A2
Position
4; 4 D2.1
AA seq 227 aa AA seqDB search
MDSETPHPGPSCQLLDLPTGPQTTSVRTLGSEPSKNEQRSSQSDSNSRKHTEESAQMVET
PRKRRRSSKDSSLVRIGNEGSLHGKKRHKTSVKKTEPKANGHQDGLAHCPEPQDTDPPPI
RKSLVSFLRGKSEEIYRDTVQMQAQKLGSLLTPEQLSQLRQLSESLTAMVYSLLQHGQPG
GFAFPAEGWLVPAPMAAPQELSGKESQSPLMEGGEKITDPAIPSDKS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggattcagaaacaccccatccaggcccttcctgtcaactgctggacctccccactgga
ccacagaccacctctgtcaggacattaggatcagaaccaagtaaaaatgagcagaggtcc
agccaatcagacagcaattccagaaagcacactgaagaatcagctcagatggtggaaaca
cccaggaaaagaagacgctcttccaaggactccagcctggtcagaataggaaatgagggc
agcttgcatgggaaaaagagacacaagacttcagtaaagaagactgagccaaaagccaat
ggtcaccaggatggattagcccattgcccagaacctcaggatacagacccaccacccatt
cggaagagcctggtgagctttctgcgggggaagtctgaggagatttatagagacacagtc
cagatgcaggcccagaagcttggctccctgctcacccctgagcagctctctcagctcaga
cagctctcagagtctctgactgccatggtatacagccttctacagcatggccaaccagga
ggctttgccttccctgctgagggctggcttgtcccagcccccatggctgcccctcaggag
ctgtctggcaaggaatctcagagtcctttgatggagggaggagagaagataacagatcct
gccatcccatcagacaagtcctga

DBGET integrated database retrieval system