KEGG   Mus musculus (mouse): 433931
Entry
433931            CDS       T01002                                 

Symbol
Pigg, Gp, Gpi7
Name
(RefSeq) phosphatidylinositol glycan anchor biosynthesis, class G
  KO
K05310  ethanolamine phosphate transferase 2 subunit G [EC:2.7.-.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    433931 (Pigg)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     433931 (Pigg)
SSDB
Motif
Pfam: Phosphodiest Sulfatase
Other DBs
NCBI-GeneID: 433931
NCBI-ProteinID: NP_001074703
MGI: 3576484
Ensembl: ENSMUSG00000029263
Vega: OTTMUSG00000028929
UniProt: D3Z4I0
Position
5; 5 F
AA seq 975 aa
MRLGSGAFAASCVAIEVIGVAIFIRGFFPAPVRSSARPEHDAETPAPEPVAGVRSNWTKL
PPPLFSKVVIVLIDALRDDFVFGSKGVKYMPYTTYLVEKGASHSFVAEAKPPTVTMPRIK
ALMTGSLPGFVDVIRNLNSPVLLEDNVLRQAKAAGKRIIFYGDETWVKLFPKHFVEYDGT
TSFFVSDYIEVDKNVTRHLDKVLKRGDWDVLILHYLGLDHIGHISGPNSPLIGHKLSEMD
SVLMKIHTSLLSKDRETLLPSLLVLCGDHGMSETGSHGASSTEEVSTPLLLISSAFERKP
GDIRHPKHVQQTDLAATLAIGLGLPIPKDSVGSLLFPVIEGKPMREQLRFLHLNTLQLSK
LLQENVPSYEKDPGFEQFKMAEKLHGNWVKLHLEENHSDILLGLGTKVLRHYLGALKTLS
LSLSTQVAQYDMYSMAVLALFLLSTPHVLCRKAELDVPLLSPVFSLLFYLVFLVLSAIHV
LVCTSSESSCYLCSLSWLAVGAVMLLVSALFCAILSALIRMVIDSTLLKKNAADASSGWS
EVNLLLLLGTVGHVLSLGASSFVEEEHQTWYFLINTLCLALSQETCRSYFLGDECEPQRH
SHVEQQCVNLLACPLQDSTSYNTPESGTAGKRVSLLEAQGSCKWWTVLASPWLVLLCCRL
LRSLNQTGVQGAHRPDFSHWLTSSDHKVQLSGLAALSLVVIFMLVQRRCSLVSKVALALG
LLGVFCYRAAIGIVQFPWQSDNKGISKGIIEARFVYVFVLGILFTGTKDLLKAQVIATDF
KTKTVGLWEMHSGLVLLAALLLRPHNLPVLAFSLLIQTVMTKFIWKPLRHDAAEITVMHY
WFGQAFFYFQGNSNNIATIDISAGFVGLDTYMEVPATFLTVFGTYVGPVLWASHLVYFLS
SEGNNSALSRSCFCYALICSVPVATYIVLVTSLRYHLFIWSVFSPKLLYEGMHLLITAAI
CAVFTATNQTRHRRA
NT seq 2928 nt   +upstreamnt  +downstreamnt
atgcggctgggctccggggccttcgctgccagctgcgtagcgattgaggtgatcggggtc
gcgatatttattcggggattcttcccagctcctgttcgttcctctgctagaccagagcac
gatgcagagaccccagcgcccgaacccgtagcaggagtccgttcgaactggaccaagctg
ccaccacctctcttcagtaaagtggttattgtgttgatagatgcattaagagatgatttt
gtgtttgggtcgaaaggtgtgaagtatatgccctacacaacgtatctggtagaaaaagga
gcatctcatagctttgtggctgaggcaaagccacccacagttactatgcctcgaatcaag
gcattgatgacaggaagtctccctggctttgttgatgtcatcaggaatctcaattctcct
gtgctcctagaagacaatgtgttaagacaggcaaaagctgctgggaaaagaattatcttt
tatggagatgaaacatgggttaaattattcccaaagcactttgtggaatatgatgggaca
acatcattctttgtgtcagattatatagaggtggataaaaatgtcacaaggcatttggac
aaagtattaaaaagaggagactgggatgtgttaatccttcactatctaggactggatcac
attggccacatttctgggcccaacagccccctgattggtcacaagctcagcgaaatggac
agtgtgctgatgaagatccacacttcactgctgtcgaaggacagagagactctcttaccc
agtttgctggttctctgtggtgaccatggaatgtctgagactgggagccatggggcctct
tccactgaggaagtgagcacacctctgctcctaatcagctctgcatttgaaagaaaacct
ggggatattcgacacccgaagcatgtccagcagactgacttggctgcaacactggcaata
ggacttggtttgccaattcctaaagacagtgtaggaagcctcttattcccagttatagag
ggaaaaccgatgagagaacaactgagatttttacatttaaacacattacagcttagcaaa
ctattgcaagaaaatgtaccatcctatgaaaaagatcctggatttgagcaatttaaaatg
gcagaaaagttacatggaaactgggtcaaactgcacttggaggaaaaccattcagacatt
ctgcttggcctggggaccaaagtactcaggcattacctgggtgccctgaagaccctgagt
ctgtccctgagcacacaagtggctcaatatgacatgtactccatggcagttctcgccctg
ttcctccttagcactccacatgtgctgtgcagaaaggctgagctggatgttcctctgttg
tcgcctgtgttttcgctgctcttttacttggtgtttttggttctttcggccattcatgtc
ctggtgtgcacctcatctgagagctcgtgctacctctgtagcctctcgtggctggcagtg
ggggctgtgatgctacttgtgtctgcgctgttctgtgcaattttgtctgctcttatcagg
atggtcattgacagcactctgctgaagaagaatgcagctgatgccagctcagggtggtca
gaggtgaacctccttcttcttctgggcacagtgggccatgttctgagcctgggagccagc
agcttcgtggaggaagagcaccagacgtggtattttcttattaatactctgtgcctggct
ctgagccaggaaacctgtaggagttactttctgggagatgaatgtgaaccccagcgtcac
tcccatgtggaacaacaatgtgtgaatctccttgcctgtcctctgcaggacagcacaagc
tacaatacccctgagtctggcacggcaggtaaacgggtctcccttctggaagcacaagga
agctgcaaatggtggacagtgctggcaagtccatggctggtgctgctctgctgtcggctg
ctgcggtccttgaaccagacaggggtgcagggagcgcatcgccccgactttagccactgg
cttaccagctctgaccacaaagtacagctttcaggcctggctgccctctccctggttgta
atcttcatgttagttcaaaggaggtgctcccttgtatccaaggtggcccttgcactgggg
ctgctgggtgtcttctgctacagggcggccattgggattgtgcagttcccatggcaatca
gacaacaaaggcatttcaaagggaattattgaagctcgttttgtttatgtctttgtcctt
ggtattctgttcaccggtaccaaagatttacttaaagcacaagtcattgcaacagacttc
aaaaccaagactgtaggcttgtgggaaatgcatagtggattagttcttctggcagctttg
ctcttgagaccacacaatcttccagtgttagcatttagtctcttgattcagactgtgatg
actaagttcatctggaagcccctgagacatgatgcagctgagatcactgtaatgcattat
tggttcggtcaagcattcttctatttccagggtaattccaacaacattgctaccatcgac
atttcagcaggctttgtgggcttagatacctacatggaagttccagccacattcctcaca
gtatttggaacatatgtagggcctgtgctctgggccagccaccttgtgtacttcctgagc
tcagaaggaaacaattcagcactgagccgttcgtgcttctgctatgcactgatttgttct
gttccagttgccacatacattgtcctggtgacatctctgcgctatcatttattcatatgg
agtgtattttctccaaagcttctctatgaaggaatgcatctgctcatcacggctgccatt
tgtgcagtgttcactgccacaaaccagactcgccacaggagggcttag

DBGET integrated database retrieval system