KEGG   Mus musculus (mouse): 434197
Entry
434197            CDS       T01002                                 

Gene name
Fam169b, EG434197
Definition
(RefSeq) family with sequence similarity 169, member B
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Acetyltransf_7 Acetyltransf_1
Other DBs
NCBI-GeneID: 434197
NCBI-ProteinID: NP_001013833
MGI: 3644026
Ensembl: ENSMUSG00000074071
Vega: OTTMUSG00000031025
UniProt: Q8CHT6
Position
7 C; 7
AA seq 337 aa
MAVYKEAYPVDILEDDAEGYQAAAEAYYEMLREGAQTSAEVISLSTGEQVRLETSSLCFC
TIYRDEPQHKILGLVNPQDTKTVVAVYLKESWWSIEDILRTSDPTREGLMKVQSFGERIV
LFVLNVIVFGRLERRLHIDDMFFLPHPAKEQAKILWKDGAAVAFYSVKMKGSLCGDGTGT
CYLLPVLDTVFVRRKNRCQGLGTAMLRDFCDTFQGDEALGISCPISPAMYRVLRQFLLTC
PGERGRLWEVEPPGAWGQQRVNIWLKVYLQERRLQDGSTVHPKCSEEDTDTPGQASQEDG
PTQFNHGESHKEWAVGEPERTQNGRRCAQVCEEARQV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcagtttataaagaggcttaccctgtggacatcctggaggatgacgcggagggctat
caggcagcagccgaggcttactatgagatgctcagggaaggagcccagacctcagcagag
gttatctccctttccactggggagcaggtcagacttgagacttcatctctttgtttttgc
acgatataccgtgatgaacctcaacataaaatactgggtttggttaatccccaggacaca
aagacagttgtggctgtttacttaaaggaatcctggtggtccatcgaagacatcctaaga
acttctgatcccacgcgggaagggctcatgaaggttcagtcctttggggaaaggattgtt
ctctttgttctcaacgtcattgtttttggaagactggagagaaggctgcacatcgatgac
atgtttttcttacctcaccctgcgaaggagcaagctaagattctgtggaaagatggagcc
gcggttgcattttactcagtcaaaatgaaaggcagcctctgtggtgatggtaccggcaca
tgctacctgctgcctgtcttggacaccgtgtttgtgaggaggaagaaccgttgccaaggc
ctggggacagccatgctgagggacttctgtgacacctttcaaggagacgaagctctgggt
atcagttgtccgatatctcctgcaatgtacagagtcctcaggcagttcctgttgacctgt
ccaggcgagagagggcgcttgtgggaggtggagcccccgggggcctggggccagcagcgt
gttaacatctggctcaaggtttatcttcaggagcggagacttcaagatgggagcaccgtg
caccctaaatgttctgaagaggacacggacactcccgggcaggcttctcaggaggatgga
cccacacagtttaatcatggagaaagccacaaggagtgggctgttggagaaccggagagg
acacagaatggccgacgctgtgcgcaagtgtgtgaggaagcgcgtcaggtgtga

DBGET integrated database retrieval system