KEGG   Mus musculus (mouse): 434204
Entry
434204            CDS       T01002                                 

Gene name
Whamm, BB081391, Whdc1, mKIAA1971
Definition
(RefSeq) WAS protein homolog associated with actin, golgi membranes and microtubules
  KO
K20479  WASP homolog-associated protein with actin, membranes and microtubules
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    434204 (Whamm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    434204 (Whamm)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    434204 (Whamm)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    434204 (Whamm)
SSDB
Motif
Pfam: JMY WHAMM-JMY_N WH2 PhaP_Bmeg
Other DBs
NCBI-GeneID: 434204
NCBI-ProteinID: NP_001004185
MGI: 2142282
Ensembl: ENSMUSG00000045795
Vega: OTTMUSG00000059180
UniProt: Q571B6
Position
7; 7 D3
AA seq 793 aa
MDSEQPDSLDGWVPLREDLFPEPERHQLRFLVAWNAAKGQFAVTCHDRTAQRRRRERREA
GDGGCSWAGVLSPAGFRGAHRQLAALWPALEPCFPPLPPELDAASGAGWGLGRGLWALLW
PLLWPAPADPGDSALQELCRQLEHYLGLAAEGCGGATVRDVLFPAPGDSADCEGLSEFRE
RTLRARLGQTATRLHQVLQDHGKANTMVALMKVYQEEDELYQELVTMATTFFQYLLQPFR
DMREVATSCKLGILKSLDEDELGPRRVAALQKEASEWTRQAEEAVGSIQDITVNYFKETV
TALTGMQKQMEQDQKRFGQAAWATAMPRLENLKLMLARETLQLMRAKELCLKHRQAEIQR
KVEDLPRQGKQLDVVDELEIQCYEIQLELYDVKLEMLRNEETILVTRLDSVKRLITEKQA
EVIYYDPCESPEELQSLAPDLELHLGDNRELRALSQQCQRLEAQRGRICSRRALLRNRKD
HCRENHQLRLQQAKQSLRHLHQHHSIQMKRDKVKEEEQKKKEWIDHERQKTLERLRAYKE
KCPAHRSALKTTCSESMVSNLPGGRSQKRLSTAHHHKTAHPASSKTGSAVPLPEASVRPP
EHQDPCGSVPVQAFVPVSDQTLSGSSEDLSLPPQPPAPPLPPPPPPPPPPPLPPALSSFQ
GTTHQNLGLRTLATEDRPLPLACDPSAGRPCDYQGPGSMDEVLASLRQGKASLRKVETPT
LPHPGTSVNEQVLAAIRQGVQLKKVHTGQGVDPGKKSTSDLERSIREALERIKKVSADSE
EDNDEPSPTEWDR
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggacagcgagcagcccgacagcctggatggctgggttccgctgcgtgaggacctcttc
ccggagcccgagcgccatcagctgcgtttcctggtggcctggaacgccgcgaagggccag
ttcgccgtcacctgtcacgaccgcacggcgcagcggcggcggcgcgagcggcgggaggcc
ggcgacgggggatgtagctgggccggggtgctgtcgcccgccgggttccgcggcgcgcac
cggcagctggcggcgctgtggccggccctggagccctgcttcccgccgctgccgcccgag
ctggacgcggcgagcggcgcgggctggggcctgggacgcgggctgtgggccctcctgtgg
ccgctcctgtggccggcgcctgcggaccctggcgactcggcgctgcaggagctgtgccgg
cagctggagcactacctgggcctggcggccgaaggatgcggcggcgccaccgtgcgcgac
gtgctcttcccggccccgggtgactcggcagactgcgagggcctgagcgagttccgcgag
aggacgctgcgcgctcgcctgggccaaacggccacccggctgcaccaggttcttcaagat
cacgggaaagccaataccatggtagcattaatgaaagtttatcaagaggaagatgagctc
tatcaagaattagttaccatggcaaccacattcttccagtatttactgcagccatttaga
gacatgcgagaagttgcaacttcatgtaagcttggtattttgaagtccctggatgaggat
gagctgggtcctagaagggtggctgccctacagaaggaagccagtgaatggaccagacag
gctgaagaagcagtgggctctatccaagacatcactgtgaattattttaaagaaacagta
acagcactaacaggaatgcagaaacaaatggagcaggatcagaagagatttggccaggct
gcctgggccacagccatgcccaggctagaaaatctcaagctcatgttagctcgggagact
ctgcagcttatgagagccaaagagctgtgtctaaaacacaggcaagctgaaatccagaga
aaggtggaagatcttccgcgccaaggaaagcagttagatgttgtggatgagctggagata
cagtgttatgagatccagttggagttgtatgatgtcaagcttgagatgctgagaaatgag
gagacaatccttgtcacgcggttggactctgttaagagacttataacagagaagcaggct
gaagtgatctactacgacccgtgtgagagccccgaggagctgcagagcctggctcctgac
ctggaactgcaccttggtgacaacagagagctgagagcactcagccagcagtgccagcgg
ctggaggctcagcggggccgcatctgctccaggagagccctccttaggaacagaaaggat
cactgccgagaaaatcatcagctcagactgcagcaggccaaacaaagtctgagacacctt
caccagcaccacagtattcaaatgaagagagacaaagtaaaagaggaagaacaaaagaaa
aaagaatggatagaccatgaacgccagaaaacccttgagcggctaagagcatataaggag
aagtgcccggctcatcggtctgcactgaaaacaacttgttcagagtccatggtgtcaaac
ctgccaggtgggcgctctcagaagaggctctcaacggctcaccaccacaagacagctcat
cctgcctccagcaaaaccggaagtgctgttcccttacctgaagccagtgtgagaccccct
gagcatcaagacccctgtggcagtgtccctgtccaggcttttgttcctgttagtgaccag
acactgtctggatccagtgaagatctgtcactaccaccacagccaccagctcctcctctc
cctcctcctcctccccctcctccccctcctcctcttccccctgctctgtcctcttttcaa
ggtaccactcatcagaatttagggctcaggactttggcaacagaggaccggccactccca
ctagcgtgtgacccatctgctgggagaccatgtgactaccagggtccaggctctatggat
gaagtgctggcctctctccggcagggcaaagcctctctccggaaagtagaaacgcccacc
ttgccccatcctggcacctcagtcaatgaacaagttctggctgccatcagacagggcgtg
cagctgaagaaagtccacacgggccaaggtgtggatcccggcaagaagagcaccagcgac
ctggagaggagcatcagagaagccctggagagaatcaagaaagtttctgccgactcagag
gaggacaatgatgagccgagccccactgagtgggaccgctag

DBGET integrated database retrieval system