KEGG   Mus musculus (mouse): 436090
Entry
436090            CDS       T01002                                 

Symbol
Gpr62, 4933402E03Rik
Name
(RefSeq) G protein-coupled receptor 62
  KO
K08415  G protein-coupled receptor 62
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    436090 (Gpr62)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    436090 (Gpr62)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 436090
NCBI-ProteinID: NP_001153124
MGI: 3525078
Ensembl: ENSMUSG00000091735
Vega: OTTMUSG00000049535
UniProt: Q80UC6
Position
9:complement(106341161..106343184)
AA seq 358 aa
MANGSGLSVTELAGSVGFILAVLVEVGAVLGNGTLLVVVLRTPDLQDAFYLAHLCVVDLL
AAASIMPLGLLAAPPGLGTVPLDPSSCRAARFLSAALLPACTLGVAALGLARYRLIVHPL
RPGARPAPALVLTAVWSAAALLGALSLLGPPPAPPPAPARCSVLAGGLGPFRPLWAMLAF
ALPALLLLAAYGSIFLVARRAALRPPRGTRPRSDSLDSRLSFLPPLRPRLLGGKAALAPA
LAVGQFAACWLPYGCACLAPAARAAAAEATVTWVAYSAFAAHPFLYGLLQRPVRLALGRL
TRRALPRAPKACTSQAWHLQTLLRRLQELRKDPVLGPSEAPEQARELARQTPSVSEAT
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggccaacggctcggggctcagcgtcaccgaactcgcgggctcggtggggtttatcctg
gcggttctcgtagaggtgggggccgtgctgggcaacggcactctgctcgtggtggtgctg
cgcacgccggaccttcaagatgccttctacttagcgcacttgtgcgtcgtggacctgctg
gcggctgcctccatcatgcctctgggcctgctggccgcgccgcccgggctgggcactgtg
cccctggacccctcgtcgtgccgagcggcgcgcttcctctcggcggctctgctccccgca
tgcacgctcggcgtggccgctctcggcctggcgcgctaccgcctcatagtgcatccgctg
cggccaggcgcgcgcccggcgcccgcgctggtgctcaccgcggtgtggtccgcggccgcg
ctcctgggcgcgctctccttgctcgggccaccgcctgcgccacctccggccccagctcgc
tgctccgtcctggccggggggctcgggcccttccggccgctctgggcgatgctagccttc
gcgctgcccgccctcctgctgttggccgcctacggtagcatcttcctggtggcgcggcgc
gccgccctccggcctccgcgcgggacccggccccgctccgactctctagacagtcgcctc
tccttcttgccgcccctccggccacgtctgctggggggcaaggcggccctggccccagcc
ctggccgtgggccagtttgcagcctgctggctgccttatggctgcgcgtgcttggcgccc
gcggcgcgcgccgcagcggccgaggctactgtcacctgggtagcctactccgccttcgcg
gctcacccctttctctatggcctgctgcagcgcccggtgcgcctggcgctgggccgcctt
acccgccgagcgctgcctcgggccccgaaagcctgcacatcgcaagcctggcacctgcag
acactccttcggcgcctccaggaactccgcaaggaccctgtcctaggcccttctgaggca
ccagaacaggcccgagaattggcaagacagaccccgagtgtgtcagaggccacctga

DBGET integrated database retrieval system