KEGG   Mus musculus (mouse): 436440Help
Entry
436440            CDS       T01002                                 

Gene name
Gpr31b, 12-HETER, GPR31c(t), Gpr31, Gpr31c
Definition
(RefSeq) G protein-coupled receptor 31, D17Leh66b region
  KO
K08406  12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    436440 (Gpr31b)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   HETE and oxoETE
    436440 (Gpr31b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 436440
NCBI-ProteinID: NP_001013854
MGI: 1354372
Ensembl: ENSMUSG00000071311
UniProt: F8VQN3
Position
17 A1; 17 8.76 cM
AA seq 319 aa AA seqDB search
MERTNCSAASTVVETAVGTMLTLECVLGLMGNAVALWTFFYRLKVWKPYAVYLFNLVVAD
LLLATSLPFFAAFYLKGKTWKLGHMPCQVLLFLLAFSRGVGVAFLTTVALDRYLRVVHPR
LRVNLLSLRAAWGISSLIWLLMVVLTPQNLLTCRTTQNSTECPSFYPTGGAKAIATCQEV
LFFLQVLLPFGLISFCNSGLIRTLQKRLRESDKQPRIRRARVLVAIVLLLFGLCFLPSVL
TRVLVHIFQEFKSCSVQQAIVRASDIAGSLTCLHSTLSPAIYCFSNPAFTHSYRKVLKSL
RGRRKAAESPSDNLRDSYS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaccaactgctcagctgccagcactgtggtggagacagccgtgggcaccatg
ctgacactggagtgtgtgctgggccttatgggcaatgctgtggccctctggaccttcttt
taccgtctcaaagtatggaagccttatgctgtctacctgttcaacctggtggtggctgac
ctgctattggccaccagtctgccattctttgctgccttctatctgaagggcaagacctgg
aaacttggacacatgccctgccaagtcctgctcttcttgctggcattcagccgtggtgtg
ggagtagccttcctgacgacagtggctttagaccggtatctgcgtgtggtccatcctcgg
ctcagagttaacttgctgtctctgagggcagcttggggcatctccagcctcatctggctt
ctgatggttgttctcactccccaaaaccttctcacttgcaggactacccagaattccacg
gaatgccccagcttctaccccacaggaggggccaaggccattgccacctgccaagaggta
ctcttcttccttcaggtcctgcttccctttggcctcatctccttctgcaacagtggcctc
atcaggaccctccagaagagactccgagagtctgacaaacagcccaggatccggagggcc
agggtgctggttgccatagtgctgctactgtttggactgtgcttcctgcctagtgtcctg
accagggttctggtgcacatctttcaggaatttaagagctgcagtgtccagcaagccata
gtgcgggcctctgacatcgctggcagcctcacctgcctgcacagtacattgagcccagcc
atttactgcttctccaatccagccttcacccactcataccggaaggtgctcaaaagcctt
cgaggcaggaggaaggcagcagagtcacctagcgacaacctcagggactcctattcctga

DBGET integrated database retrieval system