KEGG   Mus musculus (house mouse): 442827
Entry
442827            CDS       T01002                                 
Symbol
Rab44, 9830134C10Rik
Name
(RefSeq) RAB44, member RAS oncogene family
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU SRPRB EF-hand_8 Prominin
Other DBs
NCBI-GeneID: 442827
NCBI-ProteinID: NP_001351777
MGI: 3045302
Ensembl: ENSMUSG00000064147
Position
17:29333102..29367966
AA seq 973 aa
MEKGKGVSRKGRKLASSRRRQAREPADGQDAPVAAEAESWPSDADAELQGFFQDCGAKER
GFVTREDLAEARFSFLGGEEPQMIFDWVDVESRGHLSLEEFSSGLKNVFGSSPGTHRLRT
KRSLPSQRESVTSTLPVPEEADAEEKEAFLALIGQMETGHSLSEQAEIWKLWRELRQEEP
QLAGNLEGFLAKMSSRLQEAQADREALAWTLRKRDSDHLYKVRQLYEETEEQIRREKQQL
QAQSDSRGMALSAHMQEALEAKEQEVQRLAEGQRELEAQLLHLSSTQQEANRENLQLREA
ERDLAGQLEEVRGQLQVTRGHLDTARTRGKVSWQIEEEPSVPRANKEAPDPQAVPTEEAP
LPELFGNNDNWDQFLSSIEAHSHRTLRLCWSPPPSPSSTSAPQTPRIVRQISISKISALQ
FSQEPASDPDPGPRGSPEVPPGGAKDGKGVEDPKGQDEQDVSSKQPVDSPDSDARPKGSF
LWSLPGALTAESGTVEAAFRDQLAFEAEPPPQGLSSSPQSPAGSRKQTQTPDLGDKSLWS
GPDPAKQSLEREVMAEDLKLGLGSQGATALPEGATEPSLSLESVDQVGPERPVQDATHLA
RQESHAKGFQEAPGQVLSLDSLPTHLPQSLEEQLRPEEGNLGERGQQDPGSEASESHGLE
ARSMESPQQDDPLPNTSQPPAETEVPAPGQMSPPRGSPILGAGAGLAVGTPETTHTLLTL
AESEAQPGPVSMPVQVESKSGAPQPTEPEAESRPEDPRTDLQEAERSSSPGDLTAGKPQA
DPDYLYHVVFLGDSNVGKTSFLHLLHHDAFATGLTATVGVDFRVKNLLVDNKTFALQLWD
TAGQERYHSLTRQLLRKAEGVVLMYDVTSQESFTHVRYWLDCLQDAGVEGVAMVLLGNKM
DCEEERQVPTEAGRRLAQELGVSFGECSAALGHNILEPMMNLARSLKMQEDRLKASLAEV
THPQSTKRAGCCH
NT seq 2922 nt   +upstreamnt  +downstreamnt
atggagaaaggaaagggagtgtccagaaaaggccggaagctggcatccagccggcggagg
caggcacgagagccagctgacggtcaggatgcccccgtggccgcggaggctgagtcctgg
ccctctgatgctgatgcggagcttcagggcttcttccaggactgtggagccaaggaaagg
ggctttgttacccgggaggatctggcggaggccaggttcagcttcctgggtggcgaggag
ccgcagatgatatttgactgggtggacgtcgagagtaggggccacctgtcgctggaagaa
ttcagctctggactcaaaaatgtctttggctccagccctggtacccacagactccgcaca
aagcggtcattgccctctcaacgagaatctgtgacttccaccctccctgtccctgaggag
gccgatgctgaggagaaagaggccttcctggcccttatagggcagatggagactggccac
tccctttctgagcaagctgagatctggaagctgtggagagagttgcggcaggaggagccc
cagttggcaggcaacttggagggcttcctggccaagatgagcagccgtttgcaggaggct
caggcagacagggaggcactggcatggaccctgagaaagcgagactctgaccatctctac
aaggtgagacagctctacgaggagacagaggagcagatccgcagggagaagcagcagctg
caggcccagagcgactcccggggcatggccctcagtgctcacatgcaggaggccctggag
gccaaggagcaagaggttcagcggctagcagagggccagagagagctggaggctcagctc
ctccacctcagcagcacacagcaagaggccaaccgggagaacctgcagctcagggaggct
gagcgggacctagcagggcagctagaagaggtgcggggacagctgcaggtgacaagagga
cacttggatactgccaggactaggggcaaagtgtcctggcagatagaggaagagccaagt
gtccccagggcaaataaagaggctccagaccctcaggctgtccccacagaggaggcccca
ctgcctgagctgtttgggaataatgacaactgggaccagttcctcagcagcattgaagcc
cattcccacagaaccctgcggctttgctggagcccacccccaagcccgagtagcacctct
gccccccagactccccgcattgttagacagatctccatttccaagatatctgctctgcag
ttttctcaggagccagcctcagatccagacccgggtccaagaggctcccccgaggtgcct
cctggtggtgccaaagatggaaaaggggtggaggaccccaagggacaggatgaacaggat
gtcagctctaagcagcctgtggactcccctgactcagatgccagacccaagggctctttc
ctctggagcctgccaggagccctgaccgcggagtctgggactgttgaagcagctttcaga
gatcagcttgcttttgaggctgagccccctcctcaggggctctcttcctctcctcagtcc
ccagccgggtccagaaaacagacccagactccagatctgggtgacaagagcctttggtct
ggacccgatccagccaaacagtccttagaaagagaggtcatggcggaggacctgaagctg
ggtttagggtctcagggagccacagctctccctgagggagccacagagccttctctgagc
ctggagtctgtggaccaagtaggcccagagagaccagtgcaggatgcaacacatctggct
aggcaggagagccatgctaagggattccaagaagcccctggccaagtccttagtctggat
agcctgcctacccacctcccccagagtctagaggagcagctaaggcccgaggaaggaaac
ttaggagaaagaggtcagcaggaccccggatcagaagccagtgagtctcatggcctggaa
gctaggagcatggaatcaccccagcaagatgaccccctgcctaacacatcacagcctcct
gctgagacggaagtccctgctcctggccagatgtctcctccgaggggctctcccatcttg
ggggctggggctgggcttgcagtgggaaccccagagaccacacacactctccttaccctg
gctgagtcagaagcccagcctgggcccgtgtccatgcctgttcaggtggagagcaagtca
ggtgcccctcagcccacagagccagaggcagaaagcaggccggaggacccaagaacagac
ttacaggaggctgaacggagttcttcccctggggacctcactgctggcaagcctcaagct
gaccctgactacctctaccatgtcgtcttcttgggggactccaatgtgggcaagacatca
ttcctacacctgctacatcatgacgcttttgctactgggctgacggccactgtaggggtg
gattttcgtgtcaaaaacctgctggtagacaacaaaaccttcgccctgcaactgtgggac
acagctggacaagagaggtaccacagcctcacacgacagctgcttcgcaaggcagagggg
gtggtgctcatgtatgacgtcacctcccaagagagcttcacccacgtgcgttactggctc
gactgtctgcaggatgcaggtgtagagggggtggccatggtcctgctgggaaacaagatg
gactgtgaggaggagaggcaggtacccactgaagctggcagaaggctcgcccaggagctg
ggggtgtccttcggtgagtgcagcgcggccctgggtcacaatatcctggagccgatgatg
aacctggctcggtcacttaagatgcaagaagaccgcctgaaagcctcattggcagaagtg
acacacccacaatcaaccaagagagctggctgctgccactga

DBGET integrated database retrieval system