KEGG   Mus musculus (mouse): 445007
Entry
445007            CDS       T01002                                 

Gene name
Nup85, Pcn, Pcnt1, fro, frount
Definition
(RefSeq) nucleoporin 85
  KO
K14304  nuclear pore complex protein Nup85
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    445007 (Nup85)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    445007 (Nup85)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    445007 (Nup85)
   03036 Chromosome and associated proteins [BR:mmu03036]
    445007 (Nup85)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     445007 (Nup85)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    445007 (Nup85)
Motif
Pfam: Nucleopor_Nup85 TPR_4 TPR_19 TPR_14 Ribosomal_S19e
Other DBs
NCBI-GeneID: 445007
NCBI-ProteinID: NP_001002929
MGI: 3046173
Ensembl: ENSMUSG00000020739
Vega: OTTMUSG00000003479
UniProt: Q8R480
Position
11; 11 E2
AA seq 656 aa
MEELDCEPAVTWIPGVNSKKKQMCFDWGPGEMLLCETSFNQTGKSEKVPSCPFIYIIRKD
VDVYSQILRKLFNESHGIFVGLQKIEEELSGKSRKAQLVRVSKNYRSVIRACMEEMHQVA
IAAKDPASGRQFSSQVSILSAMELIWNLCEILFIEVAPAGPLLLHLLDWVRLHVCEVDSL
SADVLGGDNPSKHENFWDLVTVLVLQGRLDEARQMLAKEADANPSCAGMCRVLGDLMRTM
PILSPGNTQTLTELELKWQHWREECERHLQDNTFAANPRLESLCKIMLGDEAALLEQKEL
LSNWYHFLVTRLLYSNPTVKPIDLHFYAQSSLDMFLGGESSPEPLDNILMAAFEFDIHQV
IKECSIALSNWWFVAHLTDLLDHCRLLQSHNLYFGSNMREFLLLEYASGLFAHHSLWQLG
VDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVKSICKILAMKAVRN
NRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGSAMMLSDRLTFLGK
YREFHRLYGEKRFGDAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYEL
MRCLEDLASGRPECGEPDAQRLQDDDIETTKVEMLRLALARNLARAIIREGSLEGS
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggaggagctcgactgcgagcccgcagtaacttggattccaggtgtgaattccaagaag
aagcaaatgtgttttgactggggccccggcgagatgcttctgtgtgaaacttccttcaac
caaacaggcaaatcagagaaggtgccgagctgcccttttatctacatcatacggaaagat
gtggatgtttactctcaaattttgagaaaactcttcaatgaatcccatggaatctttgtt
ggcctgcaaaaaattgaggaagaactgtcggggaagtccaggaaagctcaattggttcga
gtgagtaaaaattaccgttcagtcatacgggcctgtatggaagaaatgcatcaggttgca
attgctgctaaagatccagccagtggccggcagttcagcagccaggtctccattttgtca
gccatggagctcatttggaacctgtgtgagattctctttattgaagtagcaccagctggc
cctctcctccttcaccttcttgactgggtccgactgcacgtgtgcgaggtggacagtttg
tcggcagatgtcctgggcggtgacaacccaagcaagcatgaaaacttctgggacctggtg
actgttctggtgcttcagggccggctcgatgaggcacggcagatgctagccaaagaagct
gatgccaacccctcttgtgcaggcatgtgccgcgtccttggggacctgatgaggacaatg
cccattctcagccctggcaatactcagacactgacagagttggagctgaagtggcagcac
tggcgtgaggagtgtgaaagacacttacaagacaacacatttgcagccaacccccgtctg
gagtctctctgcaagatcatgctgggagatgaggccgccttgttggagcagaaggagctt
ctgagcaactggtaccatttcttagtgacgaggctgctgtactctaaccccacagtgaag
cccattgacctgcacttctatgcccagtccagcctagacatgtttcttggaggtgagagc
agtccagaaccactggacaacatcttgatggcggcctttgagttcgacattcaccaggtg
atcaaagagtgcagcatcgccctgagcaactggtggttcgtagctcacctcacagacctt
ttggatcactgcagactcctccagtcacacaatctctattttggttctaacatgagagaa
ttcctcctgctggagtacgcctcaggactgtttgctcaccacagcctgtggcagctgggg
gtggactactttgattactgcccggagctaggccgagtttccttggagctgcacattgag
cggattcctctcaacacagagcagaaagccttgaaggtgctgaggatttgtgagcagcgg
cagatgactgagcaagttaaaagcatctgtaagatcttggccatgaaggctgttcgtaat
aaccgcttgggctcagcactctcctggagcatccgtgccaaagatgctgcctttgccaca
ctcgtatctgacagattcctccgggattactgtgagagaggctgcttttctgacttggat
ctcattgacaatctggggtcagccatgatgctcagtgatcgactgacgtttctgggaaag
taccgggagttccacagactgtacggggagaagcgctttggtgacgctgcttctcttctg
ctgtccctcatgacctctcagattgcacctcgttctttctggatgactctgctcacagat
gcccttcctcttttggaacagaaacaggtgattttttcagcagagcagacatatgagctg
atgcggtgcctggaagacttggcctcagggaggccagagtgtggtgaacctgatgcccag
cgactgcaggatgacgacatagagaccaccaaggtggagatgctgagactggctcttgcc
cggaatcttgctcgggcaattataagggaaggctcactggagggttcctga

DBGET integrated database retrieval system