KEGG   Mus musculus (mouse): 448987
Entry
448987            CDS       T01002                                 

Gene name
Fbxl7, AL023057, D230018M15Rik, FBL, FBL7, Fbl6
Definition
(RefSeq) F-box and leucine-rich repeat protein 7
  KO
K10273  F-box and leucine-rich repeat protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    448987 (Fbxl7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     448987 (Fbxl7)
SSDB
Motif
Pfam: LRR_6 LRR_4 F-box-like F-box PTE
Other DBs
NCBI-GeneID: 448987
NCBI-ProteinID: NP_795933
MGI: 3052506
Ensembl: ENSMUSG00000043556
UniProt: Q5BJ29
Position
15; 15 B1
AA seq 491 aa
MGANNGKQYGSEGKGSSSVSSDVSSSTDHTPTKAQRNVATSEDSDLSMRTLSTPSPALIC
PPTLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDH
SMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQD
TPNVCLMLETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL
EHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
THLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC
GRITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL
ESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVSVEALRFVKRHCKR
CVIEHTNPAFF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgggcgcgaacaatggcaaacagtacggcagtgagggcaaaggcagctcaagcgtctca
tccgacgtgagttcaagcacagatcatacaccaaccaaagcccagaggaatgtggccacc
agcgaagattctgacttgagcatgcgcacactgagcacgcccagcccagccttgatatgc
ccaccgactttgccaggatttcagaatggaaggggttcgtccacatcttcatcctccatc
accggggagacagtggctatggttcactccccgcccccgacccgcctcactcacccactc
attcggctcgcctccagaccccagaaagagcaagccagcatagacaggctcccggaccac
tccatggtgcagatcttctccttcctgcccaccaaccagctatgtcgctgtgcacgtgtg
tgccgccgctggtacaacctggcctgggacccgcgcctctggaggactatccgtctcact
ggagagaccatcaatgtggaccgtgccctgaaagtactgacccgcaggctttgccaggac
acccccaatgtgtgtctcatgctggagactgtcattgtcagtggctgccggcggctcaca
gaccgggggctttataccattgcacagtgctgtccagaactgaggcgcctggaagtctca
ggatgttacaatatctcgaacgaggctgtctttgatgtggtgtcactctgtcccaacctg
gagcatctggatgtgtcagggtgctccaaagtgacctgcatcagcttgacccgggaggcc
tccattaaactgtcccccttacatggcaaacagatttccatccgataccttgatatgacg
gactgcttcgtgctggaggacgaaggcttacacaccatcgcagctcactgcacgcagctc
actcacctctatctgcgccgctgcgtccgcctcacagatgagggtctccgctacctggtg
atctactgcacttccatcaaggagctgagtgtcagcgactgccgctttgtcagtgacttt
ggcctgcgggagattgctaaactggagtcccgcttgaggtacctcagcatcgcccactgc
ggccgcatcacggatgtgggcattcgttatgtggctaaatactgcagcaaattacgctac
ctcaatgcgaggggctgcgagggcatcacggaccatggtgtggagtacctcgccaagaac
tgtacaaaacttaagtcgctggacattggtaaatgtcccctggtctccgacacgggcctg
gaatccctggctttgaactgcttcaatctcaagaggctaagcctcaagtcctgtgagagc
atcaccggccagggcctgcagatcgtggctgccaactgcttcgacctgcagatgttaaat
gtccaggactgtgaagtttccgtggaggccctgcggtttgtgaagcgccattgcaagcgc
tgtgtcattgagcataccaaccccgctttcttctga

DBGET integrated database retrieval system