KEGG   Mus musculus (mouse): 493809
Entry
493809            CDS       T01002                                 

Gene name
Taar3
Definition
(RefSeq) trace amine-associated receptor 3
  KO
K05051  trace amine associated receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    493809 (Taar3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    493809 (Taar3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    493809 (Taar3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx DUF4191
Other DBs
NCBI-GeneID: 493809
NCBI-ProteinID: NP_001008429
MGI: 3527427
Ensembl: ENSMUSG00000069708
Vega: OTTMUSG00000019213
UniProt: Q5QD16 D8KZH8
Position
10; 10 A4
AA seq 343 aa
MDLIYIPEDLSSCPKFGNKSCPPTNRSFRVRMIMYLFMTGAMVITIFGNLVIIISISHFK
QLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFGDSFCKFHASFDMMLSLTSIF
HLCSIAIDRFYAVCDPLHYTTTMTVSMIKRLLAFCWAAPALFSFGLVLSEANVSGMQSYE
ILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSRRHARALSDMPANTKG
AVGKNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLDLLVWLGYF
NSTCNPLIHGFFYPWFRKALQFIVSGKIFRSNSDTANLFPEAH
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggatctaatatacattcccgaagacttatccagctgtccaaaatttggaaataaatcc
tgccctcccaccaatcgctctttccgtgtccgcatgataatgtacctgtttatgactgga
gccatggttatcaccatctttggaaacttagtgataatcatttccatatcgcatttcaaa
cagctacattctcccaccaactttctgatcctctccatggcaaccacggacttcctgctg
ggttttgtcatcatgccttacagtatggtgagatcagtggagagctgctggtatttcgga
gacagcttttgcaaattccacgcgagcttcgacatgatgctaagcctgacgtccatattc
cacctgtgctccatcgcgatcgaccggttttatgcagtgtgtgaccctttgcactacacc
accaccatgacggtatccatgatcaagagactgctggctttttgctgggcagccccagct
ctcttttcgtttggtttagttctgtcagaggccaatgtttctggtatgcagagctacgag
attcttgttgcttgcttcaatttctgtgcgcttacgttcaacaagttttgggggaccata
ctgttcactacctgcttcttcactcctggctccatcatggttggtatttatggtaaaatt
tttattgtttctagacgacatgctcgagccctcagcgatatgcctgcgaacacaaaagga
gcagtagggaaaaacctgtctaagaaaaaggacaggaaagcagctaagaccctgggcatc
gtcatgggggtgtttctagcgtgctggctgccttgcttcctggctgttttgattgatcca
tatttagactactccacgcccatcatagtgctggatcttctggtatggctcgggtacttc
aactctacttgcaaccccctcatccatggctttttttacccgtggtttcggaaagctctt
cagtttatagtgtcaggaaaaatatttcgctctaattcagacactgcaaatctttttcct
gaagcacattaa

DBGET integrated database retrieval system