KEGG   Mus musculus (house mouse): 494468
Entry
494468            CDS       T01002                                 
Symbol
Armcx5, AW556585
Name
(RefSeq) armadillo repeat containing, X-linked 5
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Arm_2 DUF908 DUF5740
Other DBs
NCBI-GeneID: 494468
NCBI-ProteinID: NP_001009575
MGI: 2148026
Ensembl: ENSMUSG00000072969
Vega: OTTMUSG00000018771
UniProt: Q3UZB0
Position
X:134643441..134648077
AA seq 606 aa
MIGSKTKRKAREESGASSKPGTNSPANAKGKAKNQTTKAVKAEPKEEWGNQAEARDEAVA
RTQPAISTEPKTVTWKVKKKKDKTNARVMAQAKTELPAGPALVPHTKSDALPTSVVITVT
KSEVKIDTGIEASLKGAAKATDKRSIKQKPEIKKEVCVKSRAGDKAKEVCVKSSAGDKAK
EVCVKSRAGDKAKEVCVKSRAGDKASIVINTTDEDEDYVCSWFWTGEEPSVGSWFWPKEE
NPLQVYQPPPKVEEEPEPPDTFDYALKKKAAAWLRGRFIVLVPIEEPQPSLPPDGNWTLV
ATLIETPLGIRPLTKIPPYGGPYFQTLADLKNQIREKEKYGPNPNTCRCKSRTFSLEPVD
FDKLVALLKLTRDPFIHEIATMIMGISPAYPFTQDIVHDVGITVMIENFVNNPNAKKYPR
TLNINANPDAPEEVKETEAHVNKVCRDILCCPLNCSVQVEELKLLVSLSVKFDYHHVVIY
YVRYFISLLNKGSVKIKFQILRVLLCLSKNQANTRELISAEVMSSLVALFHKNESKANIL
HIIEIFENINFQFKKRAKLFTKEMFTKSELISIFREAKEFDQKLQDLTDHSDPDVRDKVI
RLILKL
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgattggctctaaaactaaaaggaaagctagagaagagtctggggcttcctcaaaacct
ggaaccaatagccctgccaatgctaaaggaaaagccaagaatcagaccactaaagccgtt
aaggcagaaccaaaagaagaatgggggaaccaggctgaggctagggatgaagcagtggcc
aggacacagccagccatttccactgagcccaagactgtgacctggaaagtaaaaaaaaag
aaagataagactaatgctagagtcatggctcaggctaagacagaactcccggcagggcct
gctttagtgcctcacaccaagtcagatgctctgcctacatctgtggtcattactgtaacc
aagtctgaagtcaagattgacactggaattgaggcatctctcaagggcgctgccaaggct
actgataagcgcagtattaagcagaagcctgagataaagaaagaggtctgtgtcaaatcc
agggctggggacaaagctaaagaggtctgtgtcaaatccagtgctggagacaaagctaaa
gaggtctgtgtcaaatccagggctggggacaaagctaaagaggtctgtgtcaaatccagg
gctggggacaaagctagtattgtcatcaacaccactgatgaggatgaagattatgtgtgt
tcctggttttggactggagaagagcctagtgtagggtcctggttctggcctaaagaagaa
aatcctcttcaagtttatcagcccccaccaaaggttgaagaagaacctgaacccccagat
acattcgactatgctttaaaaaaaaaagctgcagcatggttaaggggcaggtttattgtc
ctggtccccattgaggaaccgcagccatctttacctccagatgggaactggactctggtt
gcaaccttaattgaaactcccctgggtattcgacctttgaccaagatcccaccttatggg
ggaccttacttccagactttagccgatttaaaaaaccaaatccgggaaaaagagaagtat
ggacccaatccaaatacctgccgctgtaaatcccgcacctttagtttagagcctgttgac
tttgataagctcgttgccctacttaagttaacgagggatccgtttattcatgagatagct
acaatgataatggggatcagtcctgcttacccatttactcaagatattgttcacgatgtt
ggtattactgttatgattgaaaattttgtcaataatccaaatgctaagaaataccctaga
actttaaatataaatgccaaccctgatgcccccgaagaagtgaaagagaccgaagcacat
gtaaataaagtttgtagggacatactctgttgtcctttgaactgctctgtgcaagtggag
gagctaaagctgttagtgagcttgagtgtgaaatttgattatcaccacgtggttatctat
tatgttcgttatttcatctcactgttaaacaaaggaagtgtcaaaatcaagtttcagatt
ttaagagtccttttgtgcttgtcaaaaaatcaagcgaatacaagagaactgatcagtgct
gaagtaatgtcctcactggtcgctctctttcacaagaatgagtcaaaagctaatattctt
catatcattgaaatatttgagaatataaatttccaattcaaaaaaagggcaaaactgttt
actaaggaaatgttcactaaatctgaacttatttccatattccgggaggcaaaagagttt
gaccagaaactccaagacttaacagaccacagtgaccctgatgtgagagataaagttatc
cgattaatactcaaactctga

DBGET integrated database retrieval system