KEGG   Mus musculus (mouse): 497097
Entry
497097            CDS       T01002                                 

Symbol
Xkr4, AY534250, Gm210, XRG4, mKIAA1889
Name
(RefSeq) X-linked Kx blood group related 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: XK-related
Other DBs
NCBI-GeneID: 497097
NCBI-ProteinID: NP_001011874
MGI: 3528744
Ensembl: ENSMUSG00000051951
Vega: OTTMUSG00000026353
UniProt: Q5GH67
Position
1; 1 A1
AA seq 647 aa
MAAKSDGRLKMKKSSDVAFTPLQNSDNSGSVQGLAPGLPSGSGAEDTEAAGGGCCPDGGG
CSRCCCCCAGSGGSAGSGGSGGGGRGSGAGSAALCLRLGREQRRYSLWDCLWILAAVAVY
FADVGTDIWLAVDYYLRGQRWWFGLTLFFVVLGSLSVQVFSFRWFVHDFSTEDSSTTTTS
SCQQPGADCKTVVSSGSAAGEGEVRPSTPQRQASNASKSNIAATNSGSNSNGATRTSGKH
RSASCSFCIWLLQSLIHILQLGQIWRYLHTIYLGIRSRQSGESGRWRFYWKMVYEYADVS
MLHLLATFLESAPQLVLQLCIIVQTHSLQALQGFTAAASLVSLAWALASYQKALRDSRDD
KKPISYMAVIIQFCWHFFTIAARVITFALFASVFQLYFGIFIVLHWCIMTFWIVHCETEF
CITKWEEIVFDMVVGIIYIFSWFNVKEGRTRCRLFIYYFVILLENTALSALWYLYKAPQI
ADAFAIPALCVVFSSFLTGVVFMLMYYAFFHPNGPRFGQSPSCACDDPATAFSLPPEVAT
STLRSISNNRSVASDRDQKFAERDGCVPVFQVRPTAPPTPSSRPPRIEESVIKIDLFRNR
YPAWERHVLDRSLRKAILAFECSPSPPRLQYKDDALIQERLEYETTL
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggccgctaagtcagacgggaggctgaagatgaagaagagcagcgacgtggcgttcacc
ccgctgcagaactcggacaattcgggctctgtgcaaggactggctccaggcttgccgtcg
gggtccggagccgaggacacggaggcggccggaggcggctgctgcccggacggcggtggc
tgctcgcgctgctgctgctgctgcgcggggagcggcggctcggcgggctcgggcggctcg
ggcggcggcggccggggcagcggggcgggctctgcggcgctgtgcctgcgcctgggcagg
gagcagcggcgttactcgctgtgggactgcctctggatcctggccgccgtggccgtgtac
ttcgcggatgtgggaacggacatctggctcgcggtggactactacctgcgtggccagcgc
tggtggtttgggctcaccctcttcttcgtggtgctgggctccctttctgtgcaagtgttc
agcttccgctggtttgtgcatgatttcagcaccgaggacagctccacgaccaccacctcc
agctgccagcagcctggagcagattgcaagacggtggtcagcagtgggtctgcagccggg
gaaggcgaggttcgtccttccacgccgcagaggcaagcatccaacgccagcaagagcaac
atcgccgccaccaacagcggcagcaacagcaacggggccacccggaccagcggcaaacac
aggtctgcgtcctgctccttttgcatctggctcctgcagtcactcatccacatcttgcag
cttgggcaaatctggaggtatttgcacacaatatacttaggtatccggagccggcagagt
ggggagagcggcaggtggcggttttactggaagatggtgtacgagtatgcagatgtgagc
atgctgcatctgctagccacttttctggaaagtgctccacaattggtcctgcagctctgc
attattgtacagactcacagcttacaggccctccaaggtttcacagcagcagcctccctt
gtgtccttggcttgggccctagcctcctaccagaaggctcttcgggactcccgagatgac
aaaaagcccatcagctacatggctgtcatcattcagttctgctggcatttcttcaccatc
gctgccagggtcatcacattcgccctctttgcctcggttttccagctgtattttgggata
tttattgtcctccattggtgcatcatgactttctggattgtccactgtgagacagaattc
tgtatcaccaaatgggaagagattgtgtttgacatggtggtgggcatcatctacatcttc
agttggttcaatgtcaaggaaggcaggacacgctgcaggctgttcatttactattttgta
atccttttggaaaatacagccttgagtgcactctggtacctctacaaagctccccagatt
gcagatgcatttgccatccctgcattgtgcgtggttttcagcagctttttaacaggtgtt
gtttttatgctgatgtactatgccttctttcatcccaatgggcccagatttgggcaatca
ccaagttgtgcttgtgatgatccagccactgccttctctctgcctccagaagtagccaca
agcacactacggtccatctccaacaaccgcagtgttgccagtgaccgtgatcagaaattt
gcagagcgggatggatgtgtacctgtgtttcaagtgagaccaactgcaccacccacccca
tcatctcgaccaccacggattgaagaatcagtcattaaaattgacctgttcaggaataga
tatccagcatgggagagacatgtgttagatcgaagcctgagaaaggccattttagccttt
gaatgttccccatctcctccaaggctgcagtacaaggatgatgcccttattcaggagagg
ctggaatatgaaaccactttataa

DBGET integrated database retrieval system