KEGG   Mus musculus (mouse): 504186Help
Entry
504186            CDS       T01002                                 

Gene name
Chrna10
Definition
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 10
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    504186 (Chrna10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    504186 (Chrna10)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   504186 (Chrna10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 504186
NCBI-ProteinID: NP_001074893
MGI: 3609260
Ensembl: ENSMUSG00000066279
Vega: OTTMUSG00000061194
UniProt: B2RX82
Position
7; 7 E2
AA seq 447 aa AA seqDB search
MGTRSHHLGPGFLLLLFLPAECLGAEGRLAHKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIRIPSSLVWRPDIVLYN
KADTQPPASASTNVVVRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFGSWTHGGH
QLDVRPRGTSASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLILAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAWARVLLLGHLAKGLCVRERGEPCGQS
KPLESAPSLQPPAGPPAGPCHEPRCLCHQEALLHHVASIAGTFRSHRAAQRRHEDWKRLA
RVMDRFFLGIFFCMALVMSLLVLVQAL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggggaccaggagccaccacctgggtcctgggtttctgctcctgctctttctccctgca
gagtgcctgggagctgagggtagactggctcacaagctgtttcgtgacctgtttgccaac
tatacaagtgccttgagaccagtggcagacacagaccagactctaaatgtgaccctggag
gtgacgttgtctcagatcattgatatggatgaacggaaccaagtgctgaccttgtacctg
tggatccggcaggagtggacagacgcctacctacattgggaccccaaagcctacggtgac
ttggatgcaattcgaattcccagcagtctagtgtggcgaccagacatcgtactttacaac
aaggcggacacgcagccacctgcctcggccagcaccaacgtggttgtgcggcacgacggc
gctgtgcgctgggacgcaccggccatcacacgcagctcgtgccgtgtggatgtctctgcc
ttcccatttgacgctcagcgctgtggcctgaccttcggctcatggacgcacggcgggcac
cagctggatgtgcgacctcggggcacttccgccagtctggccgacttcgtggagaacgtt
gaatggcgtgtgctgggcatgccagcgcgcaggcgcgtgctcacctacggctgctgctcc
gagccctacccagacgtgaccttcactctgctgctgcgccgccgtgcagctgcctatgtg
tgcaacctactgctgccctgtgtgttcatctccctgctggcacctctggccttccacctg
cccgctgactccggggagaaggtgtctctgggcgtcaccgtgctcctggcgctcaccgtc
ttccagctgatcctggccgagagcatgccacctgcagagagcgttccactcatcggaaag
tactatatggccactatgaccatggtcacattctccacagcgcttaccatcctcattatg
aatctgcattactgtggccctaatgcacatccagtacctgcctgggctcgggtcctcctg
ctgggacacctagccaaaggcctgtgtgtgcgggaacgaggggagccctgtggacagtcc
aagccattagagtcagcccccagcctccagcctcctgcaggtcccccagcgggcccttgt
catgagccacggtgtctatgccaccaagaagcccttctgcatcacgtagcttccattgcc
ggcaccttccgcagccaccgggctgcccagcgccgccatgaagattggaagcgcctggcc
agagtaatggaccgctttttcctaggcatcttcttctgcatggctctggtcatgagcctc
ctggtactggtgcaagccctgtaa

DBGET integrated database retrieval system