KEGG   Mus musculus (mouse): 50493
Entry
50493             CDS       T01002                                 

Symbol
Txnrd1, T, TR, TR1, Trx, TrxR1
Name
(RefSeq) thioredoxin reductase 1
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    50493 (Txnrd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50493 (Txnrd1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    50493 (Txnrd1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     50493 (Txnrd1)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored Thi4 DAO GIDA NAD_binding_8
Other DBs
NCBI-GeneID: 50493
NCBI-ProteinID: NP_001035988
MGI: 1354175
Ensembl: ENSMUSG00000020250
UniProt: Q9JMH6
Position
10; 10 C1
AA seq 613 aa
MPVDDCWLYFPASRGRTFVQTVWVAPTCPNCCWFPGFLPPVPRPPHVPRVLLRGPRGAVL
PASRPSKTLPSSSQTPCPTDPCICPPPSTPDSRQEKNTQSELPNKKGQLQKLPTMNGSKD
PPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIP
KKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVV
YENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSL
PYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIK
FIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVG
VKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCD
YDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKII
CNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTK
RSGGDILQSGCUG
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgccagttgatgactgctggctgtacttcccagcttctcgaggtagaacctttgtgcag
actgtctgggtggcacccacttgccccaactgttgctggtttccaggttttctccctcca
gtcccccggccaccacatgtgccccgtgtgctgctgaggggccctcgtggggctgtgctt
cctgcttcacgtccctccaagacactcccctcctcatcccagacgccctgtcctactgac
ccctgtatctgccctccaccctccacacctgatagtaggcaggaaaaaaatacgcaatct
gagctgccgaacaaaaaaggccaacttcaaaagctgccaacaatgaatggctccaaagat
ccccctgggtcctatgacttcgacctgatcatcattggaggaggctcaggaggactggca
gcagctaaggaggcagccaaatttgacaagaaagtgctggtcttggattttgtcacaccg
actcctcttgggaccagatggggtctcggaggaacgtgtgtgaatgtgggttgcatacct
aagaagctgatgcaccaggcagctttgctcggacaagctctgaaagactcgcgcaactat
ggctggaaagtcgaagacacagtgaagcatgactgggagaaaatgacggaatctgtgcag
agtcacatcggctcgctgaactggggctaccgcgtagctctccgggagaaaaaggtcgtc
tatgagaatgcttacgggaggttcattggtcctcacaggattgtggcgacaaataacaaa
ggtaaagaaaaaatctattcagcagagcggttcctcatcgccacaggtgagaggccccgc
tacctgggcatccctggagacaaagagtactgcatcagcagtgatgatcttttctccttg
ccttactgcccggggaagaccctagtagttggtgcatcctatgtcgccttggaatgtgca
ggatttctggctggtatcggcttagacgtcactgtaatggtgcggtccattctccttaga
ggatttgaccaagacatggccaacaaaatcggtgaacacatggaagaacatggtatcaag
tttataaggcagttcgtcccaacgaaaattgaacagatcgaagcaggaacaccaggccga
ctcagggtgactgctcaatccacaaacagcgaggagaccatagagggcgaatttaacaca
gtgttgctggcggtaggaagagattcttgtacgagaactattggcttagagaccgtgggc
gtgaagataaacgaaaaaaccggaaagatacccgtcacggatgaagagcagaccaatgtg
ccttacatctacgccatcggtgacatcctggaggggaagctagagctgactcccgtagcc
atccaggcggggagattgctggctcagaggctgtatggaggctccaatgtcaaatgtgac
tatgacaatgtcccaacgactgtatttactcctttggaatatggctgttgtggcctctct
gaagaaaaagccgtagagaaatttggggaagaaaatattgaagtttaccatagtttcttt
tggccattggaatggacagtcccatcccgggataacaacaaatgttatgcaaaaataatc
tgcaaccttaaagacgatgaacgtgtcgtgggcttccacgtgctgggtccaaacgctgga
gaggtgacgcagggctttgcggctgcgctcaagtgtgggctgactaagcagcagctggac
agcaccatcggcatccacccggtctgtgcagagatattcacaacgttgtcagtgacgaag
cgctctgggggagacatcctccagtctggctgctgaggttaa

DBGET integrated database retrieval system