KEGG   Mus musculus (mouse): 50496
Entry
50496             CDS       T01002                                 

Gene name
E2f6, AI462434, E2F6a, E2F6b, EM, EMA
Definition
(RefSeq) E2F transcription factor 6
  KO
K09390  transcription factor E2F6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    50496 (E2f6)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    50496 (E2f6)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TrmB DUF5719 BRCA-2_OB3 vATP-synt_E
Other DBs
NCBI-GeneID: 50496
NCBI-ProteinID: NP_150373
MGI: 1354159
Ensembl: ENSMUSG00000057469
UniProt: O54917 Q8VHT4
Position
12 A1.1; 12 8.04 cM
AA seq 272 aa
MSQQRTARRQPSLLVDPAQETVRRRCRDPINVENLLPSKIRINLEENVQYVSMRKALKVK
RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIELVEKKS
KNHIRWIGSDLNNFGAAPQQKKLQAELSDLSAMEDALDELIKDCAQQLLELTDDKENERL
AYVTYQDIHGIQAFHEQIVIAVKAPEETRLDVPAPREDSITVHIRSTKGPIDVYLCEVEQ
NHSNGKTNDGIGASPSKSSHPQCPEKEDEPPQ
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagtcagcagcggacggcgcggagacagcccagcctgctggtggacccggcgcaggaa
acggtgcgccggcgttgccgagaccccatcaacgtggaaaacctactgccatcaaaaata
aggattaatctagaagaaaatgtacagtatgtgtccatgagaaaagctctgaaagtgaag
aggccccggtttgatgtgtcactggtatacttaactcggaagtttatggatctcgtcaga
tctgcccctgggggcattcttgacttaaacaaagttgccacaaaactgggtgttcggaag
aggcgagtgtatgacatcaccaatgtcttggatggcatcgaactggtggaaaagaaatct
aagaaccacattcggtggataggatctgacctgaacaactttggggccgcaccccagcag
aagaagctgcaggcagaactctccgacctgtcggccatggaagacgccttggacgagttg
attaaagattgtgctcagcaactgttggagttaacagatgacaaggaaaatgaaagacta
gcgtatgtaacctatcaggatattcacggcattcaagctttccatgaacagattgtcatt
gcagtgaaggctccagaggaaaccagactggatgttccagctcccagagaagattctatc
acagtacatattaggagcaccaaaggacccattgatgtatatttgtgtgaagtagaacag
aaccattcaaatggtaaaaccaatgatggaataggagcctctccatctaaaagcagccat
ccacaatgcccagagaaagaagacgagcctcctcagtga

DBGET integrated database retrieval system