KEGG   Mus musculus (house mouse): 50527
Entry
50527             CDS       T01002                                 
Symbol
Ero1a, ERO1-L, Ero1l
Name
(RefSeq) endoplasmic reticulum oxidoreductase 1 alpha
  KO
K10950  ERO1-like protein alpha [EC:1.8.4.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50527 (Ero1a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    50527 (Ero1a)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-
     50527 (Ero1a)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 50527
NCBI-ProteinID: NP_056589
MGI: 1354385
Ensembl: ENSMUSG00000021831
UniProt: Q8R180 Q4FK57
Position
14:complement(45520544..45556029)
AA seq 464 aa
MGRAWGLLVGLLGVVWLLRLGHGEERRPETAAQRCFCQVSGYLDDCTCDVETIDKFNNYR
LFPRLQKLLESDYFRYYKVNLKKPCPFWNDINQCGRRDCAVKPCHSDEVPDGIKSASYKY
SEEANRIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDSFCEIDDIQSPDAEYVDL
LLNPERYTGYKGPDAWRIWSVIYEENCFKPQTIQRPLASGRGKSKENTFYNWLEGLCVEK
RAFYRLISGLHASINVHLSARYLLQDTWLEKKWGHNVTEFQQRFDGILTEGEGPRRLRNL
YFLYLIELRALSKVLPFFERPDFQLFTGNKVQDAENKALLLEILHEIKSFPLHFDENSFF
AGDKNEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKLIANM
PESGPSYEFQLTRQEIVSLFNAFGRISTSVRELENFRHLLQNVH
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgggccgcgcctggggcttgctcgttggactcctgggcgtcgtgtggctgctgcgcttg
ggccacggcgaggagcggcggccggagacagcggcacagcgctgcttctgccaggttagt
ggttacctggacgactgtacctgtgatgtcgagaccatcgataagtttaataactacaga
cttttcccaagactacaaaagcttcttgaaagtgactactttagatattacaaggtgaac
ttgaagaagccttgtcctttctggaatgacatcaaccagtgtggaagaagagactgtgcc
gtcaaaccctgccattctgatgaagttcctgatggaattaagtctgcgagctacaagtat
tctgaggaagccaaccgcattgaagaatgtgagcaagctgagcgacttggagccgtggat
gagtctctgagtgaggagacccagaaagctgtacttcagtggaccaagcatgatgattcg
tcagacagcttctgcgaaattgacgatatacagtcccccgatgctgagtatgtggactta
ctccttaaccctgagcgctacacaggctacaaggggccagacgcttggaggatatggagt
gtcatctatgaagaaaactgttttaagccacagacaattcaaaggcctttggcttctggg
cgaggaaaaagtaaagagaacacattttacaactggctagaaggcctctgtgtagaaaag
agagcattctacagacttatatctggcctgcacgcaagcattaatgtgcatttgagtgca
aggtatcttttacaagatacttggctggaaaagaaatggggtcacaatgtcacagagttc
cagcagcgctttgatgggattctgactgaaggagaaggcccacgaaggctgaggaacttg
tacttcctgtacctgatagagttaagggctctctccaaagtgcttccattttttgagcgt
ccagattttcagctcttcactgggaataaagttcaggatgcagaaaacaaagcgttactt
ctggagatacttcatgaaatcaagtcatttcctttgcacttcgatgagaattcttttttt
gctggggataaaaacgaagcacataaactaaaggaggacttccggctacactttaggaac
atttcaagaatcatggactgtgttggctgcttcaagtgccgcctgtggggcaagcttcag
acgcaggggctgggcactgctctgaagatcttgttttccgaaaaactgatcgcaaatatg
ccggaaagcggaccaagttatgagttccagctaaccagacaagaaatagtatcactgttt
aatgcatttggaaggatttccacaagtgtgagagaactagagaacttcaggcacttgtta
cagaatgttcactga

DBGET integrated database retrieval system