KEGG   Mus musculus (mouse): 50528
Entry
50528             CDS       T01002                                 

Gene name
Tmprss2, D16Ertd61, D16Ertd61e
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05164  Influenza A
mmu05171  Coronavirus disease - COVID-19
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    50528 (Tmprss2)
  09162 Cancer: specific types
   05215 Prostate cancer
    50528 (Tmprss2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    50528 (Tmprss2)
   05164 Influenza A
    50528 (Tmprss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50528 (Tmprss2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     50528 (Tmprss2)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   50528 (Tmprss2)
SSDB
Motif
Pfam: Trypsin SRCR_2 DUF1986 Ldl_recept_a Hepsin-SRCR SRCR Trypsin_2
Other DBs
NCBI-GeneID: 50528
NCBI-ProteinID: NP_056590
MGI: 1354381
Ensembl: ENSMUSG00000000385
UniProt: Q9JIQ8
Position
16 C4; 16 57.53 cM
AA seq 490 aa
MALNSGSPPGIGPCYENHGYQSEHICPPRPPVAPNGYNLYPAQYYPSPVPQYAPRITTQA
STSVIHTHPKSSGALCTSKSKKSLCLALALGTVLTGAAVAAVLLWRFWDSNCSTSEMECG
SSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYG
RAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRC
IECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPL
SSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVK
PVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITP
AMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTD
WIYQQMRANS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggcattgaactcagggtcacctccaggaatcggaccttgctatgagaaccacgggtat
cagtctgagcacatctgtcctccgagaccaccagtggctcccaatggctacaacttgtat
ccagcccagtactacccatctccagtgcctcagtatgctccgaggattacaacgcaagcc
tcaacatctgtcatccacacacatcccaagtcctcaggagcactgtgcacctcaaagtct
aagaaatcgctgtgtttagccctcgccctgggcactgtcctcacgggagctgctgtggct
gctgtcttgctttggaggttctgggacagcaactgttctacgtctgagatggagtgtggg
tcttcaggcacatgcatcagctcttctctctggtgtgacggggtagcacattgtcccaac
ggagaagatgagaaccgttgtgttcgtctctacggacaaagcttcatcctccaggtttac
tcatctcagaggaaagcctggtatcccgtgtgccaggatgattggagtgagagctacggg
agagcagcatgtaaagacatgggatacaagaacaatttttattctagccaagggatacca
gaccagagcggggcaacgagctttatgaagctgaatgtgagctcaggcaacgttgacctc
tataaaaaactctaccacagtgactcatgttcatcccgcatggtggtttctttgcgctgt
atagaatgcggggttcgctcagtgaaacgccagagcaggattgtgggtggattgaatgcc
tcaccaggagactggccctggcaggtcagcctgcacgtccaaggcgtccacgtctgcgga
ggctccatcatcacccccgagtggattgtgacggccgcccactgtgtggaagaacccctc
agcagcccgaggtactggacggcatttgcgggaattctgagacagtctctcatgttctat
ggaagtagacaccaggtagaaaaagtaatttcccatccaaattacgactctaagaccaag
aataacgacattgctctcatgaagctgcagacacctttggcttttaatgatctagtgaag
ccagtgtgtctgccgaacccaggcatgatgctagacctagaccaggaatgctggatttcg
gggtggggggccacctatgagaaagggaagacctcggacgtgttgaatgctgccatggta
cccttgatcgagccctccaaatgtaatagtaaatacatatacaacaacctaatcacacca
gccatgatctgtgccggcttcctccaggggtctgtcgactcttgccagggagacagtgga
gggccgctggttactttgaagaatgggatctggtggctgattggggacacgagctggggc
tcgggctgtgccaaggcactcagacctggagtatacgggaacgtgacggtatttacagat
tggatctaccagcaaatgagggcgaacagctaa

DBGET integrated database retrieval system