KEGG   Mus musculus (mouse): 50529
Entry
50529             CDS       T01002                                 

Gene name
Mrps7, MRP-S7, Rpms7, S7mt
Definition
(RefSeq) mitchondrial ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    50529 (Mrps7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    50529 (Mrps7)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    50529 (Mrps7)
  Bacteria
    50529 (Mrps7)
  Archaea
    50529 (Mrps7)
SSDB
Motif
Pfam: Ribosomal_S7 DUF719
Other DBs
NCBI-GeneID: 50529
NCBI-ProteinID: NP_079581
MGI: 1354367
Ensembl: ENSMUSG00000046756
Vega: OTTMUSG00000003473
UniProt: Q80X85
Position
11; 11 E2
AA seq 242 aa
MAAPALRAPLRWSGLALGVRCAVWNLPGLTQVRGSRYAPEFREPLIDKEYYRKPVAELTE
EEKYDQELKKTQFIKAAAATETSSVFADPVISKFTNMMMKGGNKVLARSLMAQTLEAVKR
KQFEKYRAASAEEQATIERNPYRIFHEALKNCEPVIGLVPILKGGHFYQVPVPLADRRRR
FLAMKWMITECRENKPRRTLMPEKLSHELLEAFHNRGPVIKRKHNMHKMAEANRALAHYR
WW
NT seq 729 nt   +upstreamnt  +downstreamnt
atggctgcccccgcgctgcgcgctccgcttcgctggtccgggctggccctgggagtgagg
tgcgccgtctggaaccttccagggctcacacaggtgagggggagccgctatgcccccgaa
ttccgggagcccttgattgacaaggaatattaccgcaagccggtggcggaactcaccgaa
gaggagaagtatgaccaggagctcaagaaaacccagtttatcaaagctgcggccgcgact
gaaaccagctcggtgttcgcagacccggtcatcagcaaattcaccaacatgatgatgaag
ggaggcaacaaagttctggcccggtctctcatggctcagactctggaagctgtgaaaagg
aagcagtttgaaaagtaccgtgctgcctctgcggaggaacaggccaccattgaacggaac
ccctacaggatcttccacgaggcactcaaaaactgtgagcctgtgattgggttggtgccg
atcctcaaagggggccatttctaccaggtccccgtgcctctcgctgaccgacgtcggcgc
ttcctggccatgaagtggatgatcacagagtgccgagagaataaaccgcggcggacactt
atgccagagaaactgtcacatgagctgctggaggcttttcataaccggggtcccgtgatc
aagaggaagcacaatatgcataagatggcagaggccaaccgtgccctggcccactaccgc
tggtggtag

DBGET integrated database retrieval system