KEGG   Mus musculus (mouse): 50701
Entry
50701             CDS       T01002                                 

Gene name
Elane, Ela2, F430011M15Rik, NE
Definition
(RefSeq) elastase, neutrophil expressed
  KO
K01327  leukocyte elastase [EC:3.4.21.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    50701 (Elane)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    50701 (Elane)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50701 (Elane)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    50701 (Elane)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    50701 (Elane)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    50701 (Elane)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.37  leukocyte elastase
     50701 (Elane)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   50701 (Elane)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Other peptidases
   50701 (Elane)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   50701 (Elane)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Enzymes
   50701 (Elane)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 50701
NCBI-ProteinID: NP_056594
MGI: 2679229
Ensembl: ENSMUSG00000020125
UniProt: Q3UP87
Position
10 C1; 10 39.72 cM
AA seq 265 aa
MALGRLSSRTLAAMLLALFLGGPALASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIA
RNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVII
QLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMC
RRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFAD
WINSIIRSHNDHLLTHPKDREGRTN
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcccttggcagactatccagccggactctggctgccatgctactggcattgttcctg
ggtggcccagcactggcctcagagattgttggtggccggccggcccggccccatgcttgg
cccttcatggcatccctgcagaggcgtggaggtcatttctgtggtgccaccctcattgcc
aggaacttcgtcatgtcagcagcccactgtgtgaacggcctaaatttccggtcagtgcag
gtagtgctgggagcccatgacctgcggcgacaggagcgcactcgacagaccttctctgtg
cagcggatcttcgagaatggctttgacccatcacaactgctgaacgacattgtgattatc
cagctcaatggctccgctaccattaacgccaacgtgcaggtggcccagctgcctgcccag
ggccagggcgtgggtgacagaactccatgtctggccatgggctggggcaggttgggcaca
aacagaccatcacccagtgtgctacaagagctcaatgtgacagtggtgactaacatgtgc
cgccgtcgtgtgaacgtatgcactctggtgccacgtcggcaggcaggcatctgcttcggg
gactctggcggacccttggtctgtaacaaccttgtccaaggcattgactccttcatccga
ggaggctgtggatctggattgtacccagatgccttcgcccctgtggctgagtttgcagat
tggatcaattccattatccgaagccataatgaccaccttcttacccatcccaaagaccga
gagggcaggaccaactag

DBGET integrated database retrieval system