KEGG   Mus musculus (house mouse): 50706
Entry
50706             CDS       T01002                                 
Symbol
Postn, A630052E07Rik, OSF-2, Osf2, PLF, PN
Name
(RefSeq) periostin, osteoblast specific factor
  KO
K24790  periostin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    50706 (Postn)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Fasciclin domain-containing proteins
   50706 (Postn)
SSDB
Motif
Pfam: Fasciclin DUF211
Other DBs
NCBI-GeneID: 50706
NCBI-ProteinID: NP_056599
MGI: 1926321
Ensembl: ENSMUSG00000027750
UniProt: Q62009
Position
3:54266688..54298462
AA seq 811 aa
MVPLLPLYALLLLFLCDINPANANSYYDKVLAHSRIRGRDQGPNVCALQQILGTKKKYFS
SCKNWYQGAICGKKTTVLYECCPGYMRMEGMKGCPAVMPIDHVYGTLGIVGATTTQHYSD
VSKLREEIEGKGSYTYFAPSNEAWENLDSDIRRGLENNVNVELLNALHSHMVNKRMLTKD
LKHGMVIPSMYNNLGLFINHYPNGVVTVNCARVIHGNQIATNGVVHVIDRVLTQIGTSIQ
DFLEAEDDLSSFRAAAITSDLLESLGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASE
ALMKYHILNTLQCSEAITGGAVFETMEGNTIEIGCEGDSISINGIKMVNKKDIVTKNGVI
HLIDEVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASSLKPDGEYTLLAPVNNAFSDDTL
SMDQRLLKLILQNHILKVKVGLSDLYNGQILETIGGKQLRVFVYRTAICIENSCMVRGSK
QGRNGAIHIFREIIQPAEKSLHDKLRQDKRFSIFLSLLEAADLKDLLTQPGDWTLFAPTN
DAFKGMTSEERELLIGDKNALQNIILYHLTPGVYIGKGFEPGVTNILKTTQGSKIYLKGV
NETLLVNELKSKESDIMTTNGVIHVVDKLLYPADIPVGNDQLLELLNKLIKYIQIKFVRG
STFKEIPMTVYRPAMTKIQIEGDPDFRLIKEGETVTEVIHGEPVIKKYTKIIDGVPVEIT
EKQTREERIITGPEIKYTRISTGGGETGETLQKFLQKEVSKVTKFIEGGDGHLFEDEEIK
RLLQGDTPAKKIPANKRVQGPRRRSREGRSQ
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggttcctctcctgcccttatatgctctgctgctgctgttcctgtgtgatattaaccct
gcaaatgccaacagttactatgacaaggtcctggctcacagccgcatcaggggtcgggat
cagggcccaaacgtctgtgccctccagcaaattctgggcaccaaaaagaaatacttcagc
tcctgtaagaactggtatcaaggtgctatctgcgggaagaaaaccactgtgctatatgaa
tgctgccctggctatatgagaatggaagggatgaaaggctgccccgcagtgatgcctatt
gaccatgtttatggcacgctgggcattgtgggagccactaccactcagcactactccgat
gtctcgaagctgagagaagagattgaaggaaaagggtcatacacgtacttcgcgccgagt
aacgaggcttgggagaacctggattctgacattcgcagaggactggagaacaatgtcaat
gttgagctactgaatgccttacacagccacatggttaataagagaatgttaaccaaggac
ctgaaacacggcatggttattccttcaatgtacaacaatctggggctttttattaaccat
tatcccaatggggttgtcactgtgaactgtgctcgagtcatccatgggaaccagattgcc
acaaatggtgtcgtccatgtcattgaccgtgtcctgacacaaattggtacctccatccaa
gacttccttgaagcagaagacgacctttcatcatttagagcagccgccatcacctctgac
ctcttggagtcccttggaagagatggtcacttcacgctctttgctcccaccaatgaagct
ttcgagaaactgccacgaggtgtcctagaaaggatcatgggagacaaagtggcttctgaa
gctctcatgaagtaccacatcctaaataccctccagtgctctgaggccatcactggagga
gccgtgtttgagaccatggaaggaaacactattgagatagggtgcgaaggggacagtatc
tccattaacggaatcaagatggtgaacaagaaagacattgtgactaagaatggtgtcatc
cacctgattgatgaagtcctcattcctgattctgccaaacaagttattgagctggctgga
aaacagcaaaccactttcaccgacctggtagcccaattaggcttggcatcctctctgaag
ccagatggagagtacaccttattagcacctgtgaacaatgcgttctctgatgacactctg
agcatggaccaacgccttcttaagctaattctgcaaaatcacatattgaaagtaaaagtt
ggccttagcgacctctacaatggacagatactggaaaccattggaggcaaacaactccga
gtctttgtgtatcggacggctatctgcatagaaaactcatgcatggtgagaggaagcaag
cagggaaggaatggtgccattcacatattccgagaaatcatccaaccagcagagaaatcc
ctgcacgacaagctgcggcaagacaagcgctttagcatcttcctcagcctccttgaagct
gcagatttgaaagatctcctgacacagcccggagattggaccttgtttgcaccaaccaat
gatgccttcaagggaatgactagcgaagaaagggagcttctgattggggataaaaatgct
ctccaaaacatcattctttatcacctgaccccaggggtttatattggaaagggattcgaa
cccggagtcactaatatcctgaagaccacacagggaagcaaaatctatctgaaaggagta
aacgaaacgcttctagtgaatgagttgaagtccaaagaatctgacatcatgacgacaaat
ggtgtcatccacgtcgtggacaaactcctctatccagcagatattccagttggaaatgat
cagctcttggaattactgaacaaactgataaaatacatccaaatcaagtttgttcgtggc
agcaccttcaaagaaatccccatgactgtctatagacctgcaatgacgaagatccaaatt
gaaggtgatcccgacttcaggctgattaaagaaggcgaaacggtgacagaagtgatccac
ggagagccagtcattaaaaagtacaccaaaatcatagatggagttcctgttgaaataact
gaaaaacagactcgggaagaacgaatcattacaggtcctgagataaaatataccaggatt
tccacaggaggtggagaaacaggagagaccttgcagaaattcttgcaaaaagaggtctcc
aaggtcacaaagttcattgaaggtggcgatggtcacttatttgaagatgaggagattaaa
agactgcttcagggagacacacctgcaaagaagataccagccaacaaaagggttcaaggg
cctagaagacgatcaagagaaggccgttctcagtga

DBGET integrated database retrieval system