KEGG   Mus musculus (mouse): 50723
Entry
50723             CDS       T01002                                 

Gene name
Icosl, AU044799, B7-H2, B7RP, B7RP-1, B7h, BG071784, GI50, GL5, GL50, GL50-, GL50-B, IC, ICOS-L, Icoslg, L, LICOS, Ly115l, mKIAA0653
Definition
(RefSeq) icos ligand
  KO
K06710  inducible T-cell co-stimulator ligand
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    50723 (Icosl)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    50723 (Icosl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    50723 (Icosl)
CD molecules [BR:mmu04090]
 Proteins
  50723 (Icosl)
SSDB
Motif
Pfam: V-set C2-set_2 Ig_3 ig C1-set DUF4519 I-set PepSY_TM PMP1_2 Ig_2
Other DBs
NCBI-GeneID: 50723
NCBI-ProteinID: NP_056605
MGI: 1354701
Ensembl: ENSMUSG00000000732
UniProt: Q9JHJ8 Q544C7
Position
10; 10 C1
AA seq 322 aa
MQLKCPCFVSLGTRQPVWKKLHVSSGFFSGLGLFLLLLSSLCAASAETEVGAMVGSNVVL
SCIDPHRRHFNLSGLYVYWQIENPEVSVTYYLPYKSPGINVDSSYKNRGHLSLDSMKQGN
FSLYLKNVTPQDTQEFTCRVFMNTATELVKILEEVVRLRVAANFSTPVISTSDSSNPGQE
RTYTCMSKNGYPEPNLYWINTTDNSLIDTALQNNTVYLNKLGLYDVISTLRLPWTSRGDV
LCCVENVALHQNITSISQAESFTGNNTKNPQETHNNELKVLVPVLAVLAAAAFVSFIIYR
RTRPHRSYTGPKTVQLELTDHA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcagctaaagtgtccctgttttgtgtccttgggaaccaggcagcctgtttggaagaag
ctccatgtttctagcgggttcttttctggtcttggtctgttcttgctgctgttgagcagc
ctctgtgctgcctctgcagagactgaagtcggtgcaatggtgggcagcaatgtggtgctc
agctgcattgacccccacagacgccatttcaacttgagtggtctgtatgtctattggcaa
atcgaaaacccagaagtttcggtgacttactacctgccttacaagtctccagggatcaat
gtggacagttcctacaagaacaggggccatctgtccctggactccatgaagcagggtaac
ttctctctgtacctgaagaatgtcacccctcaggatacccaggagttcacatgccgggta
tttatgaatacagccacagagttagtcaagatcttggaagaggtggtcaggctgcgtgtg
gcagcaaacttcagtacacctgtcatcagcacctctgatagctccaacccgggccaggaa
cgtacctacacctgcatgtccaagaatggctacccagagcccaacctgtattggatcaac
acaacggacaatagcctaatagacacggctctgcagaataacactgtctacttgaacaag
ttgggcctgtatgatgtaatcagcacattaaggctcccttggacatctcgtggggatgtt
ctgtgctgcgtagagaatgtggctctccaccagaacatcactagcattagccaggcagaa
agtttcactggaaataacacaaagaacccacaggaaacccacaataatgagttaaaagtc
cttgtccccgtccttgctgtactggcggcagcggcattcgtttccttcatcatatacaga
cgcacgcgtccccaccgaagctatacaggacccaagactgtacagcttgaacttacagac
cacgcctga

DBGET integrated database retrieval system