KEGG   Mus musculus (mouse): 50753Help
Entry
50753             CDS       T01002                                 

Gene name
Fbxo8, Fbx8
Definition
(RefSeq) F-box protein 8
  KO
K10294  F-box protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50753 (Fbxo8)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     50753 (Fbxo8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 F-box-like F-box
Motif
Other DBs
NCBI-GeneID: 50753
NCBI-ProteinID: NP_056606
MGI: 1354696
Ensembl: ENSMUSG00000038206
Vega: OTTMUSG00000021103
UniProt: Q9QZN3
Position
8; 8 B2
AA seq 319 aa AA seqDB search
MGQGLWRVARNHHLQQEAYSETGYLSREQSRRVASSNISHTSHRKQAQGGIDIYHLLKAR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPEEGVSYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaggactctggagagtggccagaaaccatcatctccaacaggaagcctacagt
gagacaggctacctcagcagagaacagagcaggagagtggcttcaagcaacatttctcac
accagccaccggaaacaagcccaaggaggcattgatatctatcatcttctgaaggcaagg
aagtctaaagaacaggaggggttcataaacttggaaatgctgcctcctgagctgagcttc
accatcttatcctacctgaatgcaactgacctttgcttagcttcctgtgtttggcaagac
ctcgctaatgatgaacttctctggcaagggttgtgtaaatctacatggggtcactgctct
atatacaataagaacccacctttaggattttcttttagaaaattgtatatgcagctagat
gagggaagcctcacctttaatgccaacccagaggagggagtgagctactttatgtccaag
ggtatcctagatgattcgccaaaggaaatagcaaaatttatcttctgtaccagaacacta
aattggaaaaaactgagaatctatcttgatgaaaggagagatgtcttggatgaccttgta
accttgcataattttagaaatcagttcttgccgaatgcactgagagaattttttcgtcat
attcatgcccctgaagagcgtggggagtaccttgaaactcttataaccaagttctcacat
aggttctgtgcttgcaatcctgacctcatgcgagaacttggccttagtcctgatgctgtc
tatgtactgtgctactctttgattctactttccattgacctcactagtcctcatgtgaag
aataaaatgtcaaaaagagagtttattcgaaatacgcgccgtgctgctcagaacattagt
gaagattttgtaggacacctttatgacaacatctaccttattggccatgtggctgcataa

DBGET integrated database retrieval system