KEGG   Mus musculus (mouse): 50759Help
Entry
50759             CDS       T01002                                 

Gene name
Fbxo16, 4932435C24Rik, Fbx16
Definition
(RefSeq) F-box protein 16
  KO
K10299  F-box protein 16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50759 (Fbxo16)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     50759 (Fbxo16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box DUF4508
Motif
Other DBs
NCBI-GeneID: 50759
NCBI-ProteinID: NP_056610
MGI: 1354706
Ensembl: ENSMUSG00000034532
UniProt: Q9QZM9 Q14BG9
Position
14; 14 D1
AA seq 334 aa AA seqDB search
MMAFAPPKSIDGPKMQTKMSTWTPLNHQLLNDQVFEERRALLGKWFDKWTDSQRRRILTG
LLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSVYIFSFLDPRSLCRCAQVSWYWK
SLAELDQLWMLKCLRFNWYISFSPTPFEQGVWKKHYIQMVRELHVTKPKTPPKDEFTTAD
VQPIPGNSPDEKQSPSLAFRSSSSLRKKNNPGEKELPPWRSSDKHPTDIIRFNYLDNCDP
ELFRLGRRKRSEVTPDFKRQLRDKKNKLQDRARLRKAQSLISLSSPPKVPVRLAWPLHLP
VAPSDREAATEALLEHLQKHPGLQSPSPRLQSQS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctttgcacctccaaaaagcatcgatggccccaaaatgcagacaaagatgagt
acctggacacctctcaaccatcagcttctgaatgaccaggtatttgaagaacgaagagct
ctgctgggaaaatggtttgacaaatggacagactctcaaaggagaagaattcttacaggc
ctactagagcgctgttccctgtcccagcagaagttctgttgtcgaaagctgcaggaaaaa
atcccagcagaggccctggattttactaccaagcttccaagggtgttatctgtctacatc
ttttccttcctggatccccggagtctttgccgttgtgcacaggtgagctggtactggaag
agcttggctgagttggaccagctctggatgctcaagtgcctgcgcttcaactggtacatc
agcttctccccaacgccctttgaacagggcgtctggaaaaagcactacatccagatggtg
agagaacttcacgtcaccaagcccaagacacctccaaaggatgaattcacaactgccgat
gttcagccaattcctggcaattctccagatgagaagcagtccccttccttagcttttcgg
tcctcctcctccttaagaaagaagaataaccccggggagaaagagcttccaccttggcga
tcgtcagataagcatcccactgacatcatccgctttaattatctagacaactgtgaccct
gagctcttcaggctaggaagaagaaaaagaagcgaagtgaccccagacttcaagcgccag
ctgcgagataagaaaaataagcttcaagacagagccaggctcaggaaagcacagtcattg
atctccctgagttcccctccaaaagttccagttcgtctcgcctggcctctgcatctgcca
gtggcaccctcagaccgtgaagcagcaacggaagcactcctggagcatcttcagaaacac
cccgggcttcagtcaccctcaccgaggctccagagtcaaagctga

DBGET integrated database retrieval system