KEGG   Mus musculus (mouse): 50769Help
Entry
50769             CDS       T01002                                 

Gene name
Atp8a2, AI415030, Atpc1b, agil, wl
Definition
(RefSeq) ATPase, aminophospholipid transporter-like, class I, type 8A, member 2
  KO
K14802  phospholipid-transporting ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    50769 (Atp8a2)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     50769 (Atp8a2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    50769 (Atp8a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase E1-E2_ATPase Hydrolase Colicin_im Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 50769
NCBI-ProteinID: NP_056618
MGI: 1354710
Ensembl: ENSMUSG00000021983
Vega: OTTMUSG00000032689
UniProt: P98200
Position
14; 14 C3-D1
AA seq 1148 aa AA seqDB search
MSRATSVGDQLEAPARIIYLNQSHLNKFCDNRISTAKYSVLTFLPRFLYEQIRRAANAFF
LFIALLQQIPDVSPTGRYTTLVPLVIILTIAGIKEIIEDFKRHKADNAVNKKKTIVLRNG
MWHTIMWKEVAVGDIVKVLNGQYLPADMVLFSSSEPQGMCYVETANLDGETNLKIRQGLS
HTTDMQTRDVLMKLSGRIECEGPNRHLYDFTGNLHLDGKSSVALGPDQILLRGTQLRNTQ
WVFGVVVYTGHDSKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALFWNG
SHGGKSWYIKKMDTNSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDMDMY
YIENDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREQ
SSDDFCRMTSCTNDSCDFNDPRLLKNIEDQHPTAPCIQEFLTLLAVCHTVVPEKDGDEII
YQASSPDEAALVKGAKKLGFVFTGRTPYSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIV
RLPSGQLRLYCKGADNVIFERLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYE
EWLKVYQEASIILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIATLLKAEIK
IWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGNLLGKENDV
ALIIDGHTLKYALSFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKKRVKAITLAIG
DGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCIL
YCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESM
LRFPQLYRITQNAEGFNTKVFWGHCINALVHSLILFWVPMKALEHDTPVTSGHATDYLFV
GNIVYTYVVVTVCLKAGLETTAWTKFSHLAVWGSMLIWLVFFGVYSTIWPTIPIAPDMKG
QATMVLSSAYFWLGLFLVPTACLIEDVAWRAAKHTCKKTLLEEVQELETKSRVMGKAMLR
DSNGKRMNERDRLIKRLSRKTPPTLFRTGSIQQCVSHGYAFSQEEHGAVTQEEIVRAYDT
TKENSRKK
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgggccacgtctgttggagaccagctagaggcaccggcccgcataatttacctc
aaccaatctcatctcaacaaattctgcgacaaccggatcagtacggccaagtacagcgtg
ttgacatttctacctcgattcctgtatgagcagattaggagagctgctaacgccttcttc
ctcttcattgccttattacagcaaatcccagacgtctcaccaacaggacggtacaccacc
ctggtgcccttggtcatcattctaacgattgcaggcatcaaagagatcatagaagatttt
aaacgacataaggcagacaatgcagttaacaagaagaaaacaatagtgttaagaaatggc
atgtggcacactatcatgtggaaagaggtggcagtgggagacatcgtgaaggtcctcaat
gggcagtatcttccagcagacatggtcctgttctcctccagtgagccccaggggatgtgc
tatgttgaaactgctaacctggatggcgagacgaaccttaaaatacgacagggcttgagc
cacacaaccgacatgcagacgagggacgtgctcatgaagctgtcgggaaggatagagtgt
gaagggcccaaccgccacctctacgacttcaccggcaacctgcacttggatgggaagagc
tccgttgcccttggacctgaccagatccttctgagaggcacccagctcaggaacacacag
tgggtcttcggcgtcgttgtgtacactggacatgacagcaagctcatgcagaattcaaca
aaagcacctctcaagagatcaaatgttgagaaggtaaccaacgtgcagatcctggtgctg
tttggtatcctcctggtcatggcgctggtgagctctgtgggggccctgttctggaatggg
tctcatggcggaaagagttggtacatcaagaagatggacacgaactcagataattttggc
tacaacttgctaacgtttatcatcttgtacaacaatctgattcctatcagcctgctggtg
acacttgaggttgtgaaatacacgcaagccctcttcataaactgggacatggatatgtat
tatattgaaaatgacactcctgcaatggccaggacatcaaacctcaacgaagagctgggg
caggtaaaatacctgttttcagacaagactggaactcttacatgtaatatcatgaacttc
aagaagtgtagcattgctggtgtgacctatggccacttcccggaactagccagagagcag
tcctcagatgacttctgccggatgacttcttgtaccaatgactcatgtgacttcaatgat
cccaggctgttaaagaacatcgaggatcagcaccctacagccccttgcatacaagagttc
cttaccctgctggctgtgtgtcacaccgtcgtccccgagaaggatggagatgaaattatc
taccaagcctcgtccccagatgaagctgctttggtcaaaggagctaagaagcttggcttt
gtgtttaccgggaggacgccgtactcggtcatcatcgaagcgatgggacaagaacagaca
ttcgggatcctcaatgttctagaattttctagtgacaggaaaagaatgtctgtcattgtc
cgactgccatcaggacaacttcgactctactgcaagggagccgataacgtcatctttgaa
agactctcaaaggactcaaagtacatggaggagacgctatgccatctggaatattttgcc
acagaaggcctgcggactctgtgcgtggcctacgcagacctttctgagaatgagtatgag
gagtggctgaaagtctatcaagaggccagcatcattctgaaggacagagcccagaggctg
gaagagtgttacgagatcattgagaagaatttactgttacttggagctacagccatcgaa
gaccgtcttcaagccggcgttccagaaaccatagccactctgctgaaggcagaaatcaaa
atctgggtgttgacaggagacaaacaagaaactgcaattaatatcgggtattcctgtcgg
ttggtgtcgcagaacatggcccttatcctattgaaggaggactctttagatgcaacaagg
gcggccatcactcagcactgcacagatcttggaaatttgctgggcaaagagaacgatgtg
gccctcatcatcgatggccataccctgaagtatgcactctcctttgaagtccgcagaagt
ttcctggacctggcgctctcatgcaaagctgtcatctgctgcagagtgtcccctctgcag
aagtctgagatcgtggatgttgtgaagaagcgagtgaaagccatcaccctggccatcgga
gacggtgccaatgacgtggggatgatccagacagcccacgtaggggtcgggatcagcggg
aacgagggaatgcaggctaccaacaactcagattatgccatcgcacagttttcctacctg
gagaagctgcttttggtccacggagcctggagctacaaccgggtgaccaagtgtatcctg
tactgtttctacaagaatgtggtcctctacatcatcgagctatggttcgcctttgtgaat
ggattttctgggcagattttattcgagcgctggtgcatcggcttgtacaatgtgatcttc
acggcattgccgcccttcactctggggatcttcgagaggtcttgtactcaggagagcatg
ctcaggttcccacagctttacagaatcactcagaacgctgaaggtttcaacactaaggtt
ttctggggtcactgcatcaatgccttggttcattccctcatcctcttctgggttcccatg
aaagcgctggagcatgatactccagtaaccagcggtcatgccacagactatttgtttgtt
ggaaatattgtttacacgtacgttgtggttacagtttgtttgaaagctggtttggagacg
acagcttggacgaaattcagtcacctggcggtgtggggaagcatgctgatctggttggtg
ttcttcggtgtctattcaaccatctggccgaccatccccattgctcctgacatgaaaggg
caggcaactatggtcctgagctctgcgtacttctggttgggattgttcctggttccgact
gcgtgtttgattgaagacgtggcgtggagagcggccaagcacacctgcaaaaagactctg
ctggaggaggtgcaggagctggagaccaagtcccgagtgatgggcaaggcgatgcttcga
gacagtaacggaaagaggatgaacgagcgtgaccgtctgatcaagaggctcagcaggaag
acacctccaaccctcttccgaacaggctccatccagcagtgtgtcagccatgggtatgcc
ttttctcaagaagagcatggagctgttacacaggaggaaatagtccgcgcttatgatacc
accaaagagaattcaaggaagaaataa

DBGET integrated database retrieval system