KEGG   Mus musculus (mouse): 50771
Entry
50771             CDS       T01002                                 

Gene name
Atp9b, AA934181, Atpc2b, I, IIb, MMR
Definition
(RefSeq) ATPase, class II, type 9B
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    50771 (Atp9b)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     50771 (Atp9b)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase E1-E2_ATPase Cation_ATPase Hydrolase_3 GNVR
Other DBs
NCBI-GeneID: 50771
NCBI-ProteinID: NP_001188498
MGI: 1354757
Ensembl: ENSMUSG00000024566
UniProt: P98195 D3YV00
Position
18; 18 E3
AA seq 1146 aa
MADQIPLYPVRSAGAAASHRRAAYYSSAGPGPGADRRGRYQLEDESAHLDEMPLMMSEEG
FENDESDYHTLPRARITRRKRGLEWFVCGGWKFLCTSCCDWLINVCQRKKELKARTVWLG
CPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVVSCSQFVPALKIGYLYT
YWAPLGFVLAVTIAREAIDEFRRFQRDKEMNSQLYSKLTVRGKVQVKSSDIQVGDLIIVE
KNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSISAYVY
AQKPQLDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVM
NTSNPKNKVGLLDLELNQLTKALFLALVVLSVVMVTLQGFAGPWYRNLFRFLLLFSYIIP
ISLRVNLDMGKAAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFK
RLHLGTVSYGTDTMDEIQSHVLNSYLQVHSQPSGHNPSSAPLRRSQSSTPKVKKSVSSRI
HEAVKAIALCHNVTPVYEARAGITGETEFAEADQDFSDENRTYQASSPDEVALVRWTESV
GLTLISRDLASMQLKTPSGQVLTYCILQMFPFTSESKRMGIIVRDESTAEITFYMKGADV
AMSTIVQYNDWLEEECGNMAREGLRTLVVAKRTLTEEQYQDFESRYSQAKLSIHDRALKV
AAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSH
LVSRTQDIHVFRPVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHELVELACQC
PAVVCCRCSPTQKAHIVTLLRQHTRKRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASL
AADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLY
QGFLMVGYATIYTMFPVFSLVLDQDVKPEMAILYPELYKDLTKGRSLSFKTFLIWVLISI
YQGGILMYGALLLFEDEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAEFLSLGCYV
ASLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLKRKLSPPS
YSKLSS
NT seq 3441 nt   +upstreamnt  +downstreamnt
atggcggaccagattcccctgtaccccgtgcgcagcgcgggcgccgcagccagccacaga
cgtgcggcctactacagctccgccgggcccgggcccggtgccgaccggcgcggcaggtac
cagctggaggatgagtctgcccatttggatgaaatgccactgatgatgtctgaagaaggc
tttgagaatgatgaaagtgattaccacacattacctcgagctaggataacacggagaaag
agaggactggagtggtttgtctgtggaggatggaagttcctctgtaccagttgctgtgat
tggctaataaatgtttgtcaaaggaagaaagagctaaaagctcgaacagtatggcttgga
tgtccagagaagtgtgaagagaaacatcctaggaattctatcaaaaatcagaaatacaat
gtatttacctttatacctggggttttgtatgaacaattcaagtttttcttgaatctctat
tttctggtagtgtcctgctcacagtttgtaccagcattgaaaattggctacctctacacc
tactgggctcctctgggatttgttttggccgttacgattgcacgtgaagcgattgatgaa
tttcgacgttttcagcgagacaaggaaatgaattcacagttatatagcaagcttacagta
agaggtaaagttcaagttaagagctcagacatacaagttggagacctcatcatagtggaa
aagaaccaaagaattccatcagatatggtatttcttagaacttcagagaaagcaggttca
tgttttatccgcacggaccagctagatggtgagactgactggaagctgaaggtggcggtg
agctgcacacaacggctgccagccctcggggaccttttttctatcagtgcctatgtttat
gctcagaagccacaactggatattcatagctttgaaggaacatttaccagggaagacagt
gatcctcccattcatgagagtctcagcatagagaacactctgtgggcaagcactattgtt
gcatcaggtactgtaataggtgttgtcatttatactggaaaagagactcgaagtgtaatg
aacacatccaatccaaaaaataaggttggtttattggacctcgaactcaatcagctgaca
aaggcgctatttctggctttagttgttctttctgttgttatggtaaccttacagggattt
gcaggcccatggtaccgtaatctttttcggttcctccttctcttttcctacatcattccc
ataagtctgcgagtaaacttggatatgggcaaagcagcatatggatggatgattatgaaa
gatgagaatattcctggtacagttgttcggaccagcacaataccagaagaacttggacgc
ctggtgtacttactgacagacaaaacagggacgctcactcagaatgaaatggtatttaag
cggctccatctgggcactgtctcctacggaacggacactatggacgaaatccaaagtcac
gtcctgaattcctacctgcaggtacactcacagccaagtgggcacaacccaagctctgct
ccactgagaagaagccagtcctcaacgcctaaagtcaagaagagcgtcagcagtagaatc
catgaagcagtgaaagccattgccctttgtcataatgtcactcctgtgtatgaggctcgg
gctggcatcactggggagactgagtttgctgaagcagaccaagactttagtgatgagaac
cgcacctaccaggcctccagccccgatgaggtggcactggtacgatggacagagagtgtt
gggctcactctgatcagcagggatcttgcttccatgcagctgaagacccccagtggccag
gtcttgacctactgcatcctacagatgttccccttcacctccgagagcaagcggatgggc
atcatagtcagagatgaatccacagcagaaattacattctatatgaaaggtgctgatgtc
gcaatgtccaccattgtccagtacaatgattggctagaagaggagtgtggaaacatggca
cgagagggcctgcgaacccttgtggtagccaagaggactctgacagaagagcaataccag
gattttgagagccgatacagtcaagccaaactgagtatccatgaccgggctctgaaagtc
gctgctgttgtagaaagcctggagagagagatggagctgttgtgcctcactggggtggag
gaccagctgcaagctgatgtgaggcccacactagagatgctgcgcaatgcagggatcaag
atttggatgctaacaggcgataaactggaaacagctacttgtattgccaaaagctcacac
ttggtgtccagaacacaagacattcatgttttcagaccagtaaccagtcggggagaagcc
catttggagctaaatgcgtttagaaggaagcatgactgtgcactggttatatctggggat
tctctggaggtctgcctgaggtactacgagcatgaacttgtggagctggcctgccagtgc
cctgctgtggtctgctgccgctgctcacccacccagaaggcccacatcgtgaccctgtta
cgccagcataccagaaagcgcacctgtgccatcggcgacggagggaatgacgtgagcatg
atccaggctgctgactgtgggattgggattgaaggaaaggagggcaaacaggcttctctg
gcagcggacttctccatcacacagttcagacacatcggcaggctgctcatggtgcacgga
cggaacagctacaaacggtctgcagcacttggccagtttgtcatgcacaggggcctcatc
atctccaccatgcaggctgtgttttcttcagtcttctactttgcatctgtaccgctgtac
cagggattccttatggtagggtatgcaactatctacaccatgttcccagtgttctcctta
gtgttggaccaagatgtaaagccagagatggcgattctctacccagagctgtacaaggac
ctcaccaagggaagatccctttccttcaagaccttcctcatctgggttttgatcagtatt
taccaaggaggcatcctcatgtatggggcactgctgctcttcgaggacgagtttgtccat
gttgtggccatctccttcacagcgctgatcctgaccgagctgctcatggtggccctgact
atcaggacgtggcactggctgatggttgtggcggagttcctcagtctgggctgctatgtc
gcctcacttgcttttctaaatgagtattttggtataggcagagtgtcttttggcgctttc
ttagatgttgccttcatcacaaccgtgaccttcttgtggaaagtgtcagccatcactgtg
gtcagctgcctcccactctacgtgctcaagtacttgaagagaaagctgtcccctcccagc
tactccaagctgtcctcctga

DBGET integrated database retrieval system